diff --git a/Basic.md b/Basic.md new file mode 100644 index 00000000..e8e95ada --- /dev/null +++ b/Basic.md @@ -0,0 +1,527 @@ +# Typical Problems +## List +### Traversal +``` +# Length computation +let mut node_ptr : &ListNode = head.as_ref().unwrap(); +while let Some(ref next) = node_ptr.next { + node_ptr = next; + l+=1; +} +``` +* [234 Palindrome Linked List](src/problem/p0234_palindrome_linked_list.rs) +### Manipulation +* [206 Reverse Linked List](src/problem/p0206_reverse_linked_list.rs) +* [21 Merge Two Sorted Lists](src/problem/p0021_merge_two_sorted_lists.rs) + * By list heads +* [19 Remove Nth Node From End of List](src/problem/p0019_remove_nth_node_from_end_of_list.rs) +* [92. Reverse Linked List II](src/problem/p0092_reverse_linked_list_ii.rs) + * By mutable references +### Hard +* [25 Reverse Nodes in k-Group](src/problem/p0025_reverse_nodes_in_k_group.rs) + + +## Tree +### Preorder/Inorder/Postorder Traversal +* [94. Binary Tree Inorder Traversal](src/problem/p0094_binary_tree_inorder_traversal.rs) +* [Preorder](https://www.geeksforgeeks.org/iterative-preorder-traversal/) and [In-order](https://www.geeksforgeeks.org/iterative-preorder-traversal/) Traversal with Stack +### BFS Traversal +* [107 Binary Tree Level Order Traversal II](src/problem/p0107_binary_tree_level_order_traversal_ii.rs) +### Manipulation +* [105. Construct Binary Tree from Preorder and Inorder Traversal](src/problem/p0105_construct_binary_tree_from_preorder_and_inorder_traversal.rs) +* [106. Construct Binary Tree from Inorder and Postorder Traversal](src/problem/p0106_construct_binary_tree_from_inorder_and_postorder_traversal.rs) +* [108. Convert Sorted Array to Binary Search Tree](src/problem/p0108_convert_sorted_array_to_binary_search_tree.rs) +### Review +* [101. Symmetric Tree](src/problem/p0101_symmetric_tree.rs) +* [222. Count Complete Tree Nodes](src/problem/p0222_count_complete_tree_nodes.rs) +* [236. Lowest Common Ancestor of a Binary Tree](src/problem/p0236_lowest_common_ancestor_of_a_binary_tree.rs) + +### Hard +* [99. Recover Binary Search Tree](src/problem/p0099_recover_binary_search_tree.rs) + +## Stack +### Parsing +* [726. Number of Atoms](src/problem/p0726_number_of_atoms.rs) +During iteration, think when to update parameters, when to process these parameters and re-reinitialize them, and when to invoke recursively. Note to match parentheses when subtracting subparts for the recursive call. +### Stack-aided Monotonic Array +Extremely powerful for leftmost/rightmost smaller/greater problems in an array. +* [84. Largest Rectangle in Histogram](src/problem/p0084_largest_rectangle_in_histogram.rs) +* [907. Sum of Subarray Minimums](src/problem/p0907_sum_of_subarray_minimums.rs) +Employ to compute a min lexicographically ordered string or numbers with fixed digits, with certain actions satisfied. +* [316. Remove Duplicate Letters](src/problem/p0316_remove_duplicate_letters.rs) +* [321. Create Maximum Number](src/problem/p0312_burst_balloons.rs) + + +## Recursions +Hint: provide a _level_ parameter in each recursive call. Prefix `let level_padding : String = (0..level).map(|_|{" "}).collect();` in each print message for a clear format. +### Path Searching +* [79. Word Search](src/problem/p0079_word_search.rs) +* [212. Word Search II](src/problem/p0212_word_search_ii.rs) + +### Backtrack +A general backtrack template is provided in the [template](src/problem/p0000_template.rs). This can help the following problems: +* [78. Subsets](src/problem/p0078_subsets.rs) +* [40. Combination Sum](src/problem/p0039_combination_sum.rs) +* [77. Combinations](src/problem/p0077_combinations.rs) +* [131. Palindrome Partitioning](src/problem/p0131_palindrome_partitioning.rs) + +## Permutation +A general permutation template is provided in the [template](src/problem/p0000_template.rs). This can help the following problems: +* [31. Next Permutation](src/problem/p0031_next_permutation.rs) +(Find the last increasing adjacent pair, the first of which is indexed with k. If k not exists, reverse the entire array. Otherwise, find the greatest l such that arr[l]>arr[k]. Swap l and k, and reverse arr[k+1..]) + +## Dynamic Programming +### Knapsack +Can use DP only if the states are enumerable, e.g, the target sum is integer. +Otherwise, must apply the recursion. +### Bounded +Elements can NOT be reused. +* [416. Partition Equal Subset Sum](src/problem/p0416_partition_equal_subset_sum.rs) +* [494. Target Sum](src/problem/p0494_target_sum.rs) +### Unbounded +Elements can be reused. +* [322. Coin Change](src/problem/p0322_coin_change.rs) +* [518. Coin Change 2](src/problem/p0518_coin_change_ii.rs) +### Generalized Approach +``` +// result[i][j] represent the result to reach state j only with the first i elements. i=0 implies no elements considered. +Init result[element_count+1][state_count] + +for i = 1..=element_count: + for j = 0..=state_count: + // Bounded + this_element = element[i-1] + if j < this_element { + Derive result[i][j] from result[i-1][j] + } else if bounded { + Derive result[i][j] from result[i-1][j-this_element] + } else { + Derive result[i][j] from result[i][j-this_element] + } +result[element_count][state_count] +``` + +### Classics +* [300. Longest Increasing Subsequence](src/problem/p0300_longest_increasing_subsequence.rs) +### 2D +* [72. Edit Distance](src/problem/p0072_edit_distance.rs) +* [718. Maximum Length of Repeated Subarray](src/problem/p0718_maximum_length_of_repeated_subarray.rs) +* [1092. Shortest Common Supersequence](src/problem/p1092_shortest_common_supersequence.rs) +* [1143. Longest Common Subsequence](src/problem/p1143_longest_common_subsequence.rs) +* [Others](https://www.techiedelight.com/top-10-dynamic-programming-problems/) + +## Binary Search +Refer to the [template](src/problem/p0000_template.rs) for the classic binary search problem, such as _first greater element_, and etc. +``` +// Assume the target must exist +low = 0i32; // inclusive and can be negative +high = nums.len() as i32 - 1;// inclusive and can be negative + +while low < high { + let mid = (low + high) / 2; + // three branches can be merged. + if nums[mid]==target{ + // may additional test whether it is the first and the last to be true + // If meeting condition: return + // else shrink the range: + high = mid or mid-1 + low = mid + 1; NEVER low = mid, otherwise the loop is infinite. + } else if nums[mid] < target { + // similar as above + } else { + // similar as above + } +} +low + +// Assume the target may not exist +low = 0i32; // inclusive and can be negative +high = nums.len() as i32 - 1;// inclusive and can be negative + +while low <= high { + let mid = (low + high) / 2; + // three branches can be merged. + if nums[mid]==target{ + // may additional test whether it is the first and the last to be true + // If meeting condition: return + // else shrink the range: + high = mid - 1; or + low = mid + 1; NEVER high/low = mid, otherwise the loop is infinite. + } else if nums[mid] < target { + // similar as above + } else { + // similar as above + } +} +``` + +### Rotated Sorted List +``` +// A general approach +let left = 0; +let right = nums.len() - 1; +while low <= high { + // check mid_num + if left_num < mid_num { + // adjust the ranges given that [left, mid] is sorted. + // Assume [left, mid] is not sorted, then suppose nums[left=0]=0 nums[left+1=-1] a[mid=2]=1, this array can never be rotated to be sorted. + } else if left_num > mid_num { + // adjust the ranges given that [mid, right] is sorted. + } else { + // increment left given that left_num = mid_num + } +} +-1 +``` +* [33. Search in Rotated Sorted Array](src/problem/p0033_search_in_rotated_sorted_array.rs) +* [153. Find Minimum in Rotated Sorted Array](src/problem/p0153_find_minimum_in_rotated_sorted_array.rs) +* [81. Search in Rotated Sorted Array II](src/problem/p0081_search_in_rotated_sorted_array_ii.rs) +* [154. Find Minimum in Rotated Sorted Array II](src/problem/p0154_find_minimum_in_rotated_sorted_array_ii.rs) +### Max-min +Suitable for problems where solutions are within in a range and the tentative solution is easy to verify. +* [410. Split Array Largest Sum](src/problem/p0410_split_array_largest_sum.rs) +* [875. Koko Eating Bananas](src/problem/p0875_koko_eating_bananas.rs) + +### H-Index +* [275. H-Index II](src/problem/p0275_h_index_ii.rs) +(Find the smallest i such that citations[i] >= n-i, return n-i) +## Sort +### Bucket Sort +* [164. Maximum Gap](src/problem/p0164_maximun_gap.rs) +* [274. H-Index](src/problem/p0274_h_index.rs) +### Cardinality Sort +* [75. Sort Colors](src/problem/p0075_sort_colors.rs) +### Wiggle Sort +``` +# Handy code to produce a mapped index, like [0,2,4,1,3,5] or [0,2,4,1,3] +(0..(n+1)/2).map(|x|{2*x}).collect(); // [0,2,4] when n=5 or 6. +(0..n/2).map(|x|{2*x}).collect(); // [1,3] when n=5, or [1,3,5] when n=6. +In [1,3,0,2,4] or [1,3,5,0,2,4], every consecutive 3 are not adjacent. +``` +* [324. Wiggle Sort II](src/problem/p0324_wiggle_sort_ii.rs) +* [767. Reorganize String](src/problem/p0767_reorganize_string.rs) + +## Matrix Traversal +### Spiral +* [54. Spiral Matrix](src/problem/p0054_spiral_matrix.rs) +* [885. Spiral Matrix III](src/problem/p0885_spiral_matrix_iii.rs) +### Diagonal +* [498. Diagonal Traverse](src/problem/p0498_diagonal_traverse.rs) +* [1424. Diagonal Traverse II](src/problem/p1424_diagonal_traverse_ii.rs) + +## Bit Operation +### Basics +* [190. Reverse Bits](src/problem/p0190_reverse_bits.rs) (Repeatedly test and set) +* [191. Number of 1 Bits](src/problem/p0191_number_of_1_bits.rs) (Use x&=x-1 to repeatively unset the least significant 1-bit. ) +* [693. Binary Number with Alternating Bits](src/problem/p0693_binary_number_with_alternating_bits.rs) (Use x&(x+1)==0 to check whether x=(2^n-1)) +* [137. Single Number II](src/problem/p0260_single_number_ii.rs) (Find the single unique elements that appear k times, while the rest with n times. ) + * Implement a cyclic counter with period n for each bit when xoring elements + * Return i-th bit counter if the i-th bit is set in binary k. +* [260. Single Number III](src/problem/p0260_single_number_iii.rs) (Find the two unique elements, (x,y) that appear k (k is odd) times, while the rest with n times. ) + * Implement a cyclic counter with period n for each bit when xoring elements + * Locate any i-th bit counter, which is none-zero.(x,y differs in i-th bit). + * Separate all elements into two groups by i-th bit and redo p137 to discovery x and y. +* [29. Divide Two Integers](src/problem/p0029_divide_two_integers.rs) +* [371. Sum of Two Integers](src/problem/p0371_sum_of_two_integers.rs) +* [201. Bitwise AND of Numbers Range](src/problem/p0201_bitwise_and_of_numbers_range.rs) + + +## Series +### Palindrome +``` +NOTE: DP recursion for palindrome +is_palindrome(i,j) |= is_palindrome(k,j-1) && s[k-1] == s[j] for any k +``` + +* [5. Longest Palindromic Substring](src/problem/p0005_longest_palindromic_substring.rs) +### Stocks Trading +Key recursion: +``` +// no_stock_balances[i][k] represents the max balance at the end of i-th day with at most k txns, conditioned on no stock hold +// with_stock_balances[i][k] represents the max balance at the end of i-th day with at most k txns, conditioned on stocks holded +no_stock_balances[i<=0][*]=0; // initial condition +no_stock_balances[*][k=0]=0; // initial condition +with_stock_balances[*][k=0]=MIN; // imply N.A. to work with the below max operation + +// sell +no_stock_balances[i][k] = max(no_stock_balances[i-1][k], with_stock_balances[i-1][k] + prices[i]) +// buy +with_stock_balances[i][k] = max(with_stock_balances[i-1][k], no_stock_balances[i-1][k-1] - prices[i]) +``` + +* [121. Best Time to Buy and Sell Stock](src/problem/p0121_best_time_to_buy_and_sell_stock.rs) (k=1) + * Enumerate k dimension with named variables. + * Always replace no_stock_balances[i-1][k-1] with 0 as k=1 +* [122. Best Time to Buy and Sell Stock II](src/problem/p0122_best_time_to_buy_and_sell_stock_ii.rs) (k=inf) + * Due inf, no_stock_balances[\*][k]=no_stock_balances[\*][k-1], and similar to with_stock_balances. Hence, the dimension for k can be removed. +* [188. Best Time to Buy and Sell Stock IV](src/problem/p0188_best_time_to_buy_and_sell_stock_iv.rs) (Arbitrary k) + * Minor Optimization: since a txn must span at least two days, one day to buy and one day to sell, when k >n/2, it is equivalent to k = inf. +* [714. Best Time to Buy and Sell Stock with Transaction Fee](src/problem/p0714_best_time_to_buy_and_sell_stock_with_transaction_fee.rs) + * Similar to [P122](src/problem/p0122_best_time_to_buy_and_sell_stock_ii.rs). + * Can pay the fee either during the buy or the sell. +* [309. Best Time to Buy and Sell Stock with Cooldown](src/problem/p0309_best_time_to_buy_and_sell_stock_with_cooldown.rs) (cool down with inf k) + * with_stock_balances[i][k] = max(with_stock_balances[i-1][k], no_stock_balances[**i-2**][k-1] - prices[i]) + + +## Non-intuitive Medium +* [229. Majority Element II](src/problem/p0229_majority_element_ii.rs) + * (B-M Majority Vote) +* [238. Product of Array Except Self](src/problem/p0238_product_of_array_except_self.rs) +* [240. Search a 2D Matrix II](src/problem/p0240_search_a_2d_matrix_ii.rs) +* [241. Different Ways to Add Parentheses](src/problem/p0241_different_ways_to_add_parentheses.rs) +* [264. Ugly Number II](src/problem/p0264_ugly_number_ii.rs) + * DP +* [279. Perfect Squares](src/problem/p0279_perfect_squares.rs) + * Knapsack DP +* [307. Range Sum Query - Mutable](src/problem/p0307_range_sum_query_mutable.rs) + * Binary Index Tree, detailed [here](https://www.topcoder.com/thrive/articles/Binary%20Indexed%20Trees#introduction) + * Range sum query +* [310. Minimum Height Trees](src/problem/p0310_minimum_height_trees.rs) + * BFS from leaves +* [334. Increasing Triplet Subsequence](src/problem/p0334_increasing_triplet_subsequence.rs) + * Smart math tricks. +* [341. Flatten Nested List Iterator](src/problem/p0341_flatten_nested_list_iterator.rs) + * Pre-order Traversal with Stack. +* [365. Water and Jug Problem](src/problem/p0365_water_and_jug_problem.rs) + * Bézout's identity: if d is a multiple of gcd(x,y), then d can be represented by ax+by (a,b,x,y are integers.) +* [368. Largest Divisible Subset](src/problem/p0368_largest_divisible_subset.rs) + * 2D DP on Array +* [372. Super Pow](src/problem/p0372_super_pow.rs) + * Rely on Eulers' Theorem to form a recursion. +* [376. Wiggle Subsequence](src/problem/p0376_wiggle_subsequence.rs) + * 1D DP, greedy. +* [382. Linked List Random Node](src/problem/p0382_linked_list_random_node.rs) + * [Reservoir Sampling](https://gregable.com/2007/10/reservoir-sampling.html) + * Select k elements from an unbounded stream with uniform probability. +* [384. Shuffle an Array](src/problem/p0384_shuffle_an_array.rs) + * [FY Algorithm](https://www.geeksforgeeks.org/shuffle-a-given-array-using-fisher-yates-shuffle-algorithm/) for random shuffling. +* [390. Elimination Game](src/problem/p0390_elimination_game.rs) + * Focus on invariant head element. +* [395. Longest Substring with At Least K Repeating Characters](src/problem/p0395_longest_substring_with_at_least_k_repeating_characters.rs) + * Divide and Conquer (Not 2 Pointer). For each recursion, identify a char which can never be included in the substring, due to the insufficient frequency. Use this char as split points and continue on the substring. + +## Hard +* [4. Median of Two Sorted Arrays](src/problem/p0004_median_of_two_sorted_arrays.rs) + * Off-one error +* [10. Regular Expression Matching](src/problem/p0010_regular_expression_matching.rs) + * 2D DP +* [23. Merge k Sorted Lists](src/problem/p0023_merge_k_sorted_lists.rs) + * Divide and Conquer +* [25. Reverse Nodes in k-Group](src/problem/p0025_reverse_nodes_in_k_group.rs) + * Recursion +* [30. Substring with Concatenation of All Words](src/problem/p0030_substring_with_concatenation_of_all_words.rs) + * Iterative String comparison +* [37. Sudoku Solver](src/problem/p0037_sudoku_solver.rs) + * Recursion +* [41. First Missing Positive](src/problem/p0041_first_missing_positive.rs) + * Bitset to mark for int presence. +* [42. Trapping Rain Water](src/problem/p0042_trapping_rain_water.rs) + * Math Modeling +* [44 Wildcard Matching](src/problem/p0044_wildcard_matching.rs) + * 2D DP +* [51. N-Queens](src/problem/p0051_n_queens.rs) +* [52. N-Queens II](src/problem/p0052_n_queens_ii.rs) + * Recursion +* [60. Permutation Sequence](src/problem/p0060_permutation_sequence.rs) + * Off-one error +* [65. Valid Number](src/problem/p0065_valid_number.rs) + * Engineeringly Complex +* [68. Text Justification](src/problem/p0068_text_justification.rs) + * Engineeringly Complex +* [72. Edit Distance](src/problem/p0072_edit_distance.rs) + * 2D DP +* [76. Minimum Window Substring](src/problem/p0076_minimum_window_substring.rs) + * 2-Pointer Approach +* [84. Largest Rectangle in Histogram](src/problem/p0084_largest_rectangle_in_histogram.rs) + * Monotonic Stack. +* [85. Maximal Rectangle](src/problem/p0085_maximal_rectangle.rs) + * Similar to [84. Largest Rectangle in Histogram](src/problem/p0084_largest_rectangle_in_histogram.rs), solved with monotonic stack. +* [87. Scramble String](src/problem/p0087_scramble_string.rs) + * Bottom-up approach with the increment on the substring length + * Top-down with memoization +* [115. Distinct Subsequences](src/problem/p0115_distinct_subsequences.rs) + * 2D DP. +* [123. Best Time to Buy and Sell Stock III](src/problem/p0123_best_time_to_buy_and_sell_stock_iii.rs) + * As above +* [124. Binary Tree Maximum Path Sum](src/problem/p0124_binary_tree_maximum_path_sum.rs) + * Bottom-up Recursion. +* [127. Word Ladder II](src/problem/p0126_word_ladder_ii.rs) + * TODO: timeout +* [127. Word Ladder](src/problem/p0127_word_ladder.rs) + * BFS +* [132. Palindrome Partitioning II](src/problem/p0132_palindrome_partitioning_ii.rs) + * 2D DP on 1D array (0 <=i i s.t S\[j\]-S\[i\] within the range + * Leverage the MergeSort, similar to [315. Count of Smaller Numbers After Self](src/problem/p0315_count_of_smaller_numbers_after_self.rs). +* [329. Longest Increasing Path in a Matrix](src/problem/p0329_longest_increasing_path_in_a_matrix.rs + * 2D DP with Memoization. +* [330. Patching Array](src/problem/p0330_patching_array.rs) + * Smart Tricks by Recursion: Assume the previous i number can attain \[0,next_miss]), + * If num[i] <= next_miss:the range can be augment to [0, next_miss+num[i]) by considering num[i]. + * Else:pad the array with next_muss to augment into [0, next_miss*2) +* [335. Self Crossing](src/problem/p0335_self_crossing.rs) + * Assume edge i to be first crossed, enumerate three canonical scenarios, in which the edge is crossed by i+4,i+5,and i+6. + * Relate the scenario with the edge length conditions. +* [336. Palindrome Pairs](src/problem/p0336_palindrome_pairs.rs) + * Build a trie for the reversed strings +* [352. Data Stream as Disjoint Intervals](src/problem/p0352_data_stream_as_disjoint_intervals.rs) + * Ordered BTree Map +* [354. Russian Doll Envelopes](src/problem/p0354_russian_doll_envelopes.rs) + * Longest Increasing Subsequence +* [363. Max Sum of Rectangle No Larger Than K](src/problem/p0363_max_sum_of_rectangle_no_larger_than_k.rs) + * Two related subproblems: + * Max Sum Submatrix (KaDane's Algorithm) + * Subarray with the sum no larger than k (Compute during the Merge Sort, similar to [327. Count of Range Sum](src/problem/p0327_count_of_range_sum.rs)) +* [381. Insert Delete GetRandom O(1)](src/problem/p0381_insert_delete_getrandom_o1_duplicates_allowed.rs) + * Trick: a helper `positions : HashMap>` to track the index positions of each value in the array. It facilitates the removal of value in the middle of the array: fill the removed position with the last value in the array and update `positions` accordingly. +* [391. Perfect Rectangle](src/problem/p0391_perfect_rectangle.rs) + * Classify each point to a subset of four categories, top-left, top-right, bottom-left and bottom-right. A point can belong to multiple distinct types, but not duplicated types. + * Iterate each point for the above classification, validation and identify points in th corner. + * Again iterate each point and validate: if on corner, conforms to corner pattern. If interior, conform to T-pattern or X-pattern. + * Trick: 4 digits to encode the point type and identify pattern. +* [403. Frog Jump](src/problem/p0403_frog_jump.rs) + * Incremental approach +* [407. Trapping Rain Water II](src/problem/p0407_trapping_rain_water_ii.rs) + * The trapped water volume of a unit is determined by the lowest among all the highest units in each path towards the boundary. + * Leverage a priority queue. +* [410. Split Array Largest Sum](src/problem/p0410_split_array_largest_sum.rs) + * Binary Search with the countable result candidate and easy verification. +* [420. Strong Password Checker](src/problem/p0420_strong_password_checker.rs) + * Mathematically tricky. +* [432. All O`one Data Structure](src/problem/p0432_all_oone_data_structure.rs) + * Leverage two data structures: + * `frq_arrays`, which maps the frequency to the list of elements with the associated frequency. + * `key2frq_array_pos`, which maps the element key to the frequency and the array position. +* [440. K-th Smallest in Lexicographical Order](src/problem/p0440_k_th_smallest_in_lexicographical_order.rs) + * Leverage a denary tree, as detailed in [here](https://leetcode.com/problems/k-th-smallest-in-lexicographical-order/discuss/92242/ConciseEasy-to-understand-Java-5ms-solution-with-Explaination) + * Tricks to calculate the number of children nodes within a parent node, without expanding. +* [446. Arithmetic Slices II - Subsequence](src/problem/p0446_arithmetic_slices_ii_subsequence) + * 2D DP, with a data structure counts[i][d]. It counts the arithmetic subsequence ending at nums[i] with difference d with length at least 2. +* [458. Poor Pigs](src/problem/p0458_poor_pigs.rs) + * Smart tricks explained [here](https://leetcode.com/problems/poor-pigs/discuss/94266/Another-explanation-and-solution) +* [460. LFU Cache](src/problem/p0460_lfu_cache.py) + * `frq_lists`, which maps the frequency to the list of elements with the associated frequency. + * `key2frq_node`, which maps the element key to the frequency and the list node +* [466. Count The Repetitions](src/problem/p0466_count_the_repetitions.rs) + * Two-pointer approach to check one string is a subsequence of the other + * Make the process cyclic to accommodate for repetition. +* [472. Concatenated Words](src/problem/p0472_concatenated_words.rs) + * 2D DP to test a word is concatenated by others in a dictionary. +* [479. Largest Palindrome Product]() + * Too mathematically hard to attempt +* [480. Sliding Window Median](src/problem/p0480_sliding_window_median.rs) + * Small and big heap/BtreeMap. +* [483. Smallest Good Base](src/problem/p0483_smallest_good_base.rs) + * Mathematical Tricks explained [here](https://leetcode.com/problems/smallest-good-base/discuss/96587/Python-solution-with-detailed-mathematical-explanation-and-derivation) +* [488. Zuma Game](src/problem/p0488_zuma_game.rs) + * Backtrack for each combination of possible insertion position and chars. + * Cached to deduplicate. +* [493. Reverse Pairs](src/problem/p0493_reverse_pairs.rs) + * Count during the merge sort +* [502. IPO](src/problem/p0502_ipo.rs) + * Pick the capital-allowed with the highest profit + * Leverage min-max heap. +* [514. Freedom Trail](src/problem/p0514_freedom_trail.rs) + * 2D DP +* [517. Super Washing Machines](src/problem/p0517_super_washing_machines.rs) + * Mathematical Tricks +* [546. Remove Boxes](src/problem/p0546_remove_boxes.rs) + * 3D DP (Smart Recursion Formulation!) +* [552. Student Attendance Record II](src/problem/p0552_student_attendance_record_ii.rs) + * 3D DP (Smart and Generic Recursion Formulation!) + * 1st dimension on n:# of days + * 2nd dimension on the # of current absent days. + * 3nd dimension on the # of trailing leave days + * Given the limited cardinality, the last two dimensions can be unrolled as named variables. + +# [Collected Template](src/problem/p0000_template.rs) +* Data structure: + * BtreeMap + * BtreeSet + * HashMap + * HashSet + * Vector + * Iterator + * Heap + * Stack + * Queue +* Bit Operation +* Primitives + * Option + * Typed/Untyped structs + * User Input +* Algorithms + * Binary Search + * Union Find (Map-based & vector-based) + +# Tricks +Promient Problems +713 Element count in window sliding. +399 str Union Find + +Unsolved: +[803. Bricks Falling When Hit](src/problem/p0803_bricks_falling_when_hit.rs) +[126. Word Ladder II](src/problem/p0126_word_ladder_ii.rs) + +# Resources + +# Note +* LRU(146) and LFU(460) has to be implemented in PYTHON, as only possible to encode in unsafe rust. \ No newline at end of file diff --git a/helper.py b/helper.py new file mode 100644 index 00000000..17c248f3 --- /dev/null +++ b/helper.py @@ -0,0 +1,147 @@ +#!/bin/bash/python + +import sys +import os +import time +import re +import subprocess + + +kSolutionDir=os.path.join("src", "solution") +kProblemDir=os.path.join("src", "problem") + +def eprint(msg): + print>> sys.stderr, ("Error: {}".format(msg)) + +def test_solution(qid): + """Invoke cargo test on the given problem + """ + prob_name_pattern = r"p{0:04d}([a-zA-Z0-9_])*.rs$".format(qid) + prob_filename = "" + for filename in os.listdir(kProblemDir): + if re.match(prob_name_pattern, filename): + prob_filename = filename + break + + if prob_filename == "": + eprint("Fail to find Problem {}".format(qid)) + return 1 + + filename_no_suffix = prob_filename.split(".")[0] + command = "bash -c \"cargo test problem::{}::tests::test_{} -- --exact --nocapture\"".format(filename_no_suffix, qid) + print command + os.system(command) + + return 0 + + +def init_problem(qid): + """Init the problem without solution but with tests + """ + # Check problem not exists + prob_name_pattern = r"p{0:04d}(\D)*.rs$".format(qid) + for filename in os.listdir(kProblemDir): + if re.match(prob_name_pattern, filename): + eprint("Problem {} already exists.".format(qid)) + return 1 + + + # Remove the corresponding line in problem/mod.rs + # Otherwise, later 'cargo run' cmd may fail. + prob_mod_path = os.path.join(kProblemDir, "mod.rs") + with open(prob_mod_path) as f: + mod_lines = f.readlines() + + os.remove(prob_mod_path) + + with open(prob_mod_path, "w") as f: + f.write("") + for mod_line in mod_lines: + if not mod_line.startswith("mod p{0:04d}".format(qid)): + f.write(mod_line) + + # Invoke 'cargo run' to fetch the problem from Leetcode + command = "bash -c \"cargo run <<< {}\"".format(qid) + os.system(command) + + # Check solution exists + sol_name_pattern = r"^s{0:04d}(\D)*.rs$".format(qid) + solution_path = "" + for filename in os.listdir(kSolutionDir): + # print filename + if re.match(sol_name_pattern, filename): + solution_path = os.path.join(kSolutionDir, filename) + break + else: + continue + + if solution_path == "": + eprint("Solution {} not found in {}. No update on problem tests.".format(qid, kSolutionDir)) + return 0 + + # Get problem_lines and get line number of tests session + problem_path = "" + for filename in os.listdir(kProblemDir): + if re.match(prob_name_pattern, filename): + problem_path = os.path.join(kProblemDir, filename) + break + + if problem_path == "": + eprint("Fail to download Problem {}".format(qid)) + return 1 + + # Identify the starting line number of the test section in problem + test_line_pattern = "#[cfg(test)]" + prob_test_line_num = -1 + with open(problem_path) as f: + prob_lines = f.readlines() + + for i, prob_line in enumerate(prob_lines): + if test_line_pattern in prob_line: + prob_test_line_num = i + + if prob_test_line_num == -1: + eprint("Fail to locate test section in {}".format(problem_path)) + return 1 + + + # Identify the starting line number of the test section in solution + test_line_pattern = "#[cfg(test)]" + sol_test_line_num = -1 + with open(solution_path) as f: + solution_lines = f.readlines() + + for i, solution_line in enumerate(solution_lines): + if test_line_pattern in solution_line: + sol_test_line_num = i + + if sol_test_line_num == -1: + eprint("Fail to locate test section in {}".format(solution_path)) + return 1 + + # Concat the non-test section in problem and test section in solution + with open(problem_path, "w") as f: + f.writelines(prob_lines[0:prob_test_line_num] + solution_lines[sol_test_line_num:]) + + return 0 + +def main(): + # <= to exclude the count of sys.argv[0], the script name. + if len(sys.argv) <= 2: + print("Insufficient parameters, expecting at least {}, but actual {}".format(2, len(sys.argv)-1)) + print("python helper.py [init/test] [problem_id]") + return 1 + mode = sys.argv[1] + qid = int(sys.argv[2]) + if mode == "init": + return init_problem(qid) + elif mode == "test": + return test_solution(qid) + else: + print("Unrecognized mode {}".mode) + return 1 + + + +if __name__ == "__main__": + sys.exit(main()) \ No newline at end of file diff --git a/src/lib.rs b/src/lib.rs index 55b0298f..0425ecb6 100644 --- a/src/lib.rs +++ b/src/lib.rs @@ -1,5 +1,5 @@ #[macro_use] pub mod util; -pub mod solution; +// pub mod solution; pub mod problem; diff --git a/src/problem/mod.rs b/src/problem/mod.rs index e69de29b..f13d5fba 100644 --- a/src/problem/mod.rs +++ b/src/problem/mod.rs @@ -0,0 +1,307 @@ +mod p0001_two_sum; +mod p0053_maximum_subarray; +mod p0209_minimum_size_subarray_sum; +mod p0083_remove_duplicates_from_sorted_list; +mod p0021_merge_two_sorted_lists; +mod p0206_reverse_linked_list; +mod p0328_odd_even_linked_list; +mod p0103_binary_tree_zigzag_level_order_traversal; +mod p0104_maximum_depth_of_binary_tree; +mod p0108_convert_sorted_array_to_binary_search_tree; +mod p0226_invert_binary_tree; +mod p0098_validate_binary_search_tree; +mod p0114_flatten_binary_tree_to_linked_list; +mod p0129_sum_root_to_leaf_numbers; +mod p0031_next_permutation; +mod p0056_merge_intervals; +mod p0105_construct_binary_tree_from_preorder_and_inorder_traversal; +mod p0106_construct_binary_tree_from_inorder_and_postorder_traversal; +mod p0062_unique_paths; +mod p0153_find_minimum_in_rotated_sorted_array; +mod p0003_longest_substring_without_repeating_characters; +mod p0049_group_anagrams; +mod p0151_reverse_words_in_a_string; +mod p0071_simplify_path; +mod p0126_word_ladder_ii; +mod p0091_decode_ways; +mod p0011_container_with_most_water; +mod p0061_rotate_list; +mod p0075_sort_colors; +mod p0086_partition_list; +mod p0143_reorder_list; +mod p0147_insertion_sort_list; +mod p0148_sort_list; +mod p0445_add_two_numbers_ii; +mod p0020_valid_parentheses; +mod p0094_binary_tree_inorder_traversal; +mod p0145_binary_tree_postorder_traversal; +mod p0150_evaluate_reverse_polish_notation; +mod p0456_132_pattern; +mod p0394_decode_string; +mod p0496_next_greater_element_i; +mod p0503_next_greater_element_ii; +mod p0907_sum_of_subarray_minimums; +mod p0096_unique_binary_search_trees; +mod p0113_path_sum_ii; +mod p0199_binary_tree_right_side_view; +mod p0230_kth_smallest_element_in_a_bst; +mod p0236_lowest_common_ancestor_of_a_binary_tree; +mod p0337_house_robber_iii; +mod p0064_minimum_path_sum; +mod p0120_triangle; +mod p0131_palindrome_partitioning; +mod p0213_house_robber_ii; +mod p0300_longest_increasing_subsequence; +mod p0121_best_time_to_buy_and_sell_stock; +mod p0309_best_time_to_buy_and_sell_stock_with_cooldown; +mod p0416_partition_equal_subset_sum; +mod p0322_coin_change; +mod p0518_coin_change_ii; +mod p0494_target_sum; +mod p0046_permutations; +mod p0077_combinations; +mod p0040_combination_sum_ii; +mod p0051_n_queens; +mod p0079_word_search; +mod p0090_subsets_ii; +mod p0078_subsets; +mod p0047_permutations_ii; +mod p0130_surrounded_regions; +mod p0207_course_schedule; +mod p0987_vertical_order_traversal_of_a_binary_tree; +mod p0016_3sum_closest; +mod p0015_3sum; +mod p0029_divide_two_integers; +mod p0033_search_in_rotated_sorted_array; +mod p0034_find_first_and_last_position_of_element_in_sorted_array; +mod p0074_search_a_2d_matrix; +mod p0081_search_in_rotated_sorted_array_ii; +mod p0154_find_minimum_in_rotated_sorted_array_ii; +mod p0162_find_peak_element; +mod p0275_h_index_ii; +mod p0274_h_index; +mod p0287_find_the_duplicate_number; +mod p0378_kth_smallest_element_in_a_sorted_matrix; +mod p0222_count_complete_tree_nodes; +mod p0436_find_right_interval; +mod p0000_template;mod p0223_rectangle_area; +mod p0343_integer_break; +mod p0397_integer_replacement; +mod p0447_number_of_boomerangs; +mod p0633_sum_of_square_numbers; +mod p0054_spiral_matrix; +mod p0059_spiral_matrix_ii; +mod p0885_spiral_matrix_iii; +mod p0910_smallest_range_ii; +mod p0187_repeated_dna_sequences; +mod p0347_top_k_frequent_elements; +mod p0451_sort_characters_by_frequency; +mod p0718_maximum_length_of_repeated_subarray; +mod p0930_binary_subarrays_with_sum; +mod p0781_rabbits_in_forest; +mod p0767_reorganize_string; +mod p0969_pancake_sorting; +mod p0973_k_closest_points_to_origin; +mod p1329_sort_the_matrix_diagonally; +mod p0023_merge_k_sorted_lists; +mod p0164_maximum_gap; +mod p1647_minimum_deletions_to_make_character_frequencies_unique; +mod p1648_sell_diminishing_valued_colored_balls; +mod p0410_split_array_largest_sum; +mod p0179_largest_number; +mod p0220_contains_duplicate_iii; +mod p0324_wiggle_sort_ii; +mod p0136_single_number; +mod p0268_missing_number; +mod p0289_game_of_life; +mod p0389_find_the_difference; +mod p0421_maximum_xor_of_two_numbers_in_an_array; +mod p0260_single_number_iii; +mod p0201_bitwise_and_of_numbers_range; +mod p0318_maximum_product_of_word_lengths; +mod p0371_sum_of_two_integers; +mod p0461_hamming_distance; +mod p0693_binary_number_with_alternating_bits; +mod p0190_reverse_bits; +mod p0169_majority_element; +mod p0229_majority_element_ii; +mod p0137_single_number_ii; +mod p0076_minimum_window_substring; +mod p0239_sliding_window_maximum; +mod p0424_longest_repeating_character_replacement; +mod p0480_sliding_window_median; +mod p0713_subarray_product_less_than_k; +mod p0763_partition_labels; +mod p0128_longest_consecutive_sequence; +mod p0547_number_of_provinces; +mod p0684_redundant_connection; +mod p0399_evaluate_division; +mod p0721_accounts_merge; +mod p0959_regions_cut_by_slashes; +mod p0685_redundant_connection_ii; +mod p0803_bricks_falling_when_hit; +mod p0208_implement_trie_prefix_tree; +// mod p0146_lru_cache; +mod p0234_palindrome_linked_list; +mod p0019_remove_nth_node_from_end_of_list; +mod p0025_reverse_nodes_in_k_group; +mod p0024_swap_nodes_in_pairs; +mod p0082_remove_duplicates_from_sorted_list_ii; +mod p0203_remove_linked_list_elements; +mod p0101_symmetric_tree; +mod p0100_same_tree; +mod p0107_binary_tree_level_order_traversal_ii; +mod p0110_balanced_binary_tree; +mod p0235_lowest_common_ancestor_of_a_binary_search_tree; +mod p0095_unique_binary_search_trees_ii; +mod p0111_minimum_depth_of_binary_tree; +mod p0112_path_sum; +mod p0099_recover_binary_search_tree; +mod p0084_largest_rectangle_in_histogram; +mod p0042_trapping_rain_water; +mod p0726_number_of_atoms; +mod p0127_word_ladder; +mod p0039_combination_sum; +mod p0132_palindrome_partitioning_ii; +mod p0072_edit_distance; +mod p1143_longest_common_subsequence; +mod p1092_shortest_common_supersequence; +mod p0216_combination_sum_iii; +mod p0212_word_search_ii; +mod p0875_koko_eating_bananas; +mod p0498_diagonal_traverse; +mod p1424_diagonal_traverse_ii; +mod p0191_number_of_1_bits; +mod p0005_longest_palindromic_substring; +mod p0214_shortest_palindrome; +mod p0188_best_time_to_buy_and_sell_stock_iv; +mod p0123_best_time_to_buy_and_sell_stock_iii; +mod p0122_best_time_to_buy_and_sell_stock_ii; +mod p0714_best_time_to_buy_and_sell_stock_with_transaction_fee; +mod p0004_median_of_two_sorted_arrays; +mod p0010_regular_expression_matching; +mod p0030_substring_with_concatenation_of_all_words; +mod p0032_longest_valid_parentheses; +mod p0037_sudoku_solver; +mod p0041_first_missing_positive; +mod p0044_wildcard_matching; +mod p0052_n_queens_ii; +mod p0060_permutation_sequence; +mod p0065_valid_number; +mod p0068_text_justification; +mod p0085_maximal_rectangle; +mod p0087_scramble_string; +mod p0115_distinct_subsequences; +mod p0124_binary_tree_maximum_path_sum; +mod p0135_candy; +mod p0140_word_break_ii; +mod p0149_max_points_on_a_line; +mod p0174_dungeon_game; +mod p0218_the_skyline_problem; +mod p0224_basic_calculator; +mod p0233_number_of_digit_one; +mod p0273_integer_to_english_words; +mod p0282_expression_add_operators; +mod p0295_find_median_from_data_stream; +mod p0297_serialize_and_deserialize_binary_tree; +mod p0301_remove_invalid_parentheses; +mod p0312_burst_balloons; +mod p0315_count_of_smaller_numbers_after_self; +mod p0321_create_maximum_number; +mod p0327_count_of_range_sum; +mod p0329_longest_increasing_path_in_a_matrix; +mod p0330_patching_array; +mod p0335_self_crossing; +mod p0336_palindrome_pairs; +mod p0352_data_stream_as_disjoint_intervals; +mod p0354_russian_doll_envelopes; +mod p0363_max_sum_of_rectangle_no_larger_than_k; +mod p0381_insert_delete_getrandom_o1_duplicates_allowed; +mod p0391_perfect_rectangle; +mod p0403_frog_jump; +mod p0407_trapping_rain_water_ii; +mod p0420_strong_password_checker; +mod p0432_all_oone_data_structure; +mod p0440_k_th_smallest_in_lexicographical_order; +mod p0446_arithmetic_slices_ii_subsequence; +// mod p0460_lfu_cache;mod p0458_poor_pigs; +mod p0466_count_the_repetitions; +mod p0472_concatenated_words; +mod p0483_smallest_good_base; +mod p0488_zuma_game; +mod p0493_reverse_pairs; +mod p0502_ipo; +mod p0514_freedom_trail; +mod p0517_super_washing_machines; +mod p0546_remove_boxes; +mod p0552_student_attendance_record_ii; +mod p0006_zigzag_conversion; +mod p0008_string_to_integer_atoi; +mod p0012_integer_to_roman; +mod p0017_letter_combinations_of_a_phone_number; +mod p0018_4sum; +mod p0022_generate_parentheses; +mod p0036_valid_sudoku; +mod p0038_count_and_say; +mod p0043_multiply_strings; +mod p0048_rotate_image; +mod p0240_search_a_2d_matrix_ii; +mod p0050_powx_n; +mod p0055_jump_game; +mod p0057_insert_interval; +mod p0063_unique_paths_ii; +mod p0073_set_matrix_zeroes; +mod p0080_remove_duplicates_from_sorted_array_ii; +mod p0089_gray_code; +mod p0092_reverse_linked_list_ii; +mod p0093_restore_ip_addresses; +mod p0097_interleaving_string; +mod p0109_convert_sorted_list_to_binary_search_tree; +mod p0139_word_break; +mod p0152_maximum_product_subarray; +mod p0189_rotate_array; +mod p0198_house_robber; +mod p0200_number_of_islands; +mod p0210_course_schedule_ii; +mod p0215_kth_largest_element_in_an_array; +mod p0211_design_add_and_search_words_data_structure; +mod p0221_maximal_square; +mod p0227_basic_calculator_ii; +mod p0238_product_of_array_except_self; +mod p0241_different_ways_to_add_parentheses; +mod p0166_fraction_to_recurring_decimal; +mod p0264_ugly_number_ii; +mod p0279_perfect_squares; +mod p0299_bulls_and_cows; +mod p0304_range_sum_query_2d_immutable; +mod p0306_additive_number; +mod p0307_range_sum_query_mutable; +mod p0310_minimum_height_trees; +mod p0313_super_ugly_number; +mod p0316_remove_duplicate_letters; +mod p0319_bulb_switcher; +mod p0331_verify_preorder_serialization_of_a_binary_tree; +mod p0332_reconstruct_itinerary; +mod p0334_increasing_triplet_subsequence; +mod p0355_design_twitter; +mod p0357_count_numbers_with_unique_digits; +mod p0365_water_and_jug_problem; +mod p0368_largest_divisible_subset; +mod p0372_super_pow; +mod p0373_find_k_pairs_with_smallest_sums; +mod p0375_guess_number_higher_or_lower_ii; +mod p0376_wiggle_subsequence; +mod p0377_combination_sum_iv; +mod p0380_insert_delete_getrandom_o1; +mod p0382_linked_list_random_node; +mod p0384_shuffle_an_array; +mod p0385_mini_parser; +mod p0386_lexicographical_numbers; +mod p0341_flatten_nested_list_iterator; +mod p0388_longest_absolute_file_path; +mod p0390_elimination_game; +mod p0393_utf_8_validation; +mod p0395_longest_substring_with_at_least_k_repeating_characters; +mod p0396_rotate_function; +mod p0398_random_pick_index; +mod p0400_nth_digit; diff --git a/src/problem/p0000_template.rs b/src/problem/p0000_template.rs new file mode 100644 index 00000000..70a81b82 --- /dev/null +++ b/src/problem/p0000_template.rs @@ -0,0 +1,1864 @@ +pub struct Solution {} + +// problem: https://leetcode.com/problems/find-right-interval/ +// discuss: https://leetcode.com/problems/find-right-interval/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::{collections::HashMap, hash::Hash}; +use std::collections::BTreeMap; +use std::collections::HashSet; + + +pub fn left_rightmost_smaller_idx(nums: Vec) -> Vec { + let n = nums.len(); + + let mut left_rightmost_smaller_idx = vec![-1i32;n]; + let mut stack : Vec = vec![]; + for (i, &num) in nums.iter().enumerate() { + while let Some(&last_idx) = stack.last() { + if !(nums[last_idx] < num) { + stack.pop(); + } else { + break; + } + } + + if let Some(&last_idx) = stack.last() { + left_rightmost_smaller_idx[i] = last_idx as i32; + } else { + left_rightmost_smaller_idx[i] = -1; + } + stack.push(i); + } + left_rightmost_smaller_idx +} + +struct UnionFindInt { + parents: Vec, + subset_sizes: Vec, + pub max_subset_size: usize, + pub subset_count: usize, +} + +impl UnionFindInt { + fn new(element_count : usize) -> UnionFindInt { + let mut uf = UnionFindInt{ + parents: (0..element_count).collect(), + subset_sizes: vec![1;element_count], + max_subset_size: 1, + subset_count: element_count}; + uf + } + + fn find_root(&self, element_id : usize) -> usize { + let mut root = element_id; + while root != self.parents[root] { + root = self.parents[root]; + } + root + } + + fn find_root_with_compression(&mut self, element_id : usize) -> usize { + let root = self.find_root(element_id); + + // path compression + let mut element_id = element_id; + while self.parents[element_id] != root { + let tmp = self.parents[element_id]; + self.parents[element_id] = root; + element_id = tmp; + } + + root + } + + fn union(&mut self, e1 : usize, e2 : usize) -> bool { + let root1 = self.find_root_with_compression(e1); + let root2 = self.find_root_with_compression(e2); + if root1 == root2 { return false; } + + if self.subset_sizes[root1] < self.subset_sizes[root2] { + // anchor root1 tree under root2 tree + self.parents[root1] = root2; + self.subset_sizes[root2] += self.subset_sizes[root1]; + self.max_subset_size = std::cmp::max(self.max_subset_size, self.subset_sizes[root2]); + } else { + self.parents[root2] = root1; + self.subset_sizes[root1] += self.subset_sizes[root2]; + self.max_subset_size = std::cmp::max(self.max_subset_size, self.subset_sizes[root1]); + } + self.subset_count -=1; + true + } +} + + +struct UnionFind { + parents: HashMap, + subset_sizes: HashMap, + pub max_subset_size: usize, + pub subset_count: usize, +} + +impl UnionFind { + fn new() -> UnionFind { + let mut uf = UnionFind{ + parents: HashMap::new(), + subset_sizes: HashMap::new(), + max_subset_size: 0, + subset_count: 0}; + uf + } + + fn new_with(elements : &HashSet) -> UnionFind { + let mut uf = UnionFind{ + parents: HashMap::new(), + subset_sizes: HashMap::new(), + max_subset_size: 1, + subset_count: elements.len()}; + + for e in elements { + uf.parents.insert(e.clone(),e.clone()); + uf.subset_sizes.insert(e.clone(),1); + } + + uf + } + // None if element is not found. + fn find(&self, element : &T) -> Option { + if !self.parents.contains_key(element) { + return None; + } + + let mut root = element.clone(); + while root != *self.parents.get(&root).unwrap() { + root = self.parents.get(&root).unwrap().clone(); + } + Some(root) + } + + fn find_along_compression(&mut self, element : &T) -> Option { + if let Some(root) = self.find(element) { + // path compression: redirects each node in the path to the root. + let mut element = element.clone(); + while element != *self.parents.get(&element).unwrap() { + let tmp = self.parents[&element].clone(); + *self.parents.get_mut(&element).unwrap() = root.clone(); + element = tmp; + } + + Some(root) + } else { + None + } + } + + // return whether the union has performed. + fn union(&mut self, e1 : &T, e2 : &T ) -> bool { + let root1 = self.find_along_compression(e1); + let root2 = self.find_along_compression(e2); + + if root1.is_none() { + // assume to insert this e1 and then do union + self.parents.insert(e1.clone(),e1.clone()); + self.subset_sizes.insert(e1.clone(),1); + self.subset_count+=1; + } + + if root2.is_none() { + // assume to insert this e1 and then do union + self.parents.insert(e2.clone(),e2.clone()); + self.subset_sizes.insert(e2.clone(),1); + self.subset_count+=1; + } + + let root1= root1.unwrap_or(e1.clone()); + let root2= root2.unwrap_or(e2.clone()); + if root1 == root2 {return false;} + + let root1_size = *self.subset_sizes.get(&root1).unwrap(); + let root2_size = *self.subset_sizes.get(&root2).unwrap(); + // concat the smaller tress to the larger + if root1_size < root2_size { + *self.parents.get_mut(&root1).unwrap() = root2.clone(); + *self.subset_sizes.get_mut(&root2).unwrap() += root1_size; + } else { + *self.parents.get_mut(&root2).unwrap() = root1.clone(); + *self.subset_sizes.get_mut(&root1).unwrap() += root2_size; + } + self.max_subset_size = std::cmp::max(self.max_subset_size, root1_size + root2_size); + self.subset_count-=1; + true + } +} + +struct BinarySearch {} + +impl BinarySearch { + pub fn first_equal(nums: Vec, target: i32) -> i32 { + let mut low = 0i32; + let mut high = (nums.len() - 1) as i32; + while low <= high { + let mid = (low + high) / 2; + let mid_num = nums[mid as usize]; + if mid_num < target { + low = mid + 1; + } else if nums[mid as usize] > target { + high = mid - 1; + } else if 0 < mid && nums[(mid-1) as usize] == mid_num { + high = mid - 1; + } else { + return mid; + } + } + -1 + } + + pub fn last_equal(nums: Vec, target: i32) -> i32 { + let mut low = 0i32; + let mut high = (nums.len() - 1) as i32; + while low <= high { + let mid = (low + high) / 2; + let mid_num = nums[mid as usize]; + if mid_num < target { + low = mid + 1; + } else if nums[mid as usize] > target { + high = mid - 1; // if mid is usize and mid=0, this wil panic. + } else if (mid as usize) < nums.len() - 1 && nums[(mid+1) as usize] == mid_num { + low = mid + 1; + } else { + return mid; + } + } + -1 + } + + pub fn first_gt(nums: Vec, target: i32) -> i32 { + let mut low = 0i32; + let mut high = (nums.len() - 1) as i32; + while low <= high { + let mid = (low + high) / 2; + let mid_num = nums[mid as usize]; + // println!("low={}, mid={}, high={}, mid_num={}, target={}", low, mid, high, mid_num, target); + if target < mid_num { + if mid == 0 || nums[(mid-1) as usize] <= target { + return mid; + } + high = mid - 1; + } else { + low = mid + 1; + } + } + -1 + } + + pub fn first_ge(nums: Vec, target: i32) -> i32 { + let mut low = 0i32; + let mut high = (nums.len() - 1) as i32; + + while low <= high { + let mid = (low + high) / 2; + let mid_num = nums[mid as usize]; + // println!("low={}, mid={}, high={}, mid_num={}, target={}", low, mid, high, mid_num, target); + if target <= mid_num { + if mid == 0 || nums[(mid-1) as usize] < target { + return mid; + } + high = mid - 1; + } else { + low = mid + 1; + } + } + -1 + } + + // assert_eq!(Solution::last_lt(vec![1,1,3,3,5,5],2), 2); + pub fn last_lt(nums: Vec, target: i32) -> i32 { + let mut low = 0i32; + let mut high = (nums.len() - 1) as i32; + let l = nums.len() as i32; + while low <= high { + let mid = (low + high) / 2; + let mid_num = nums[mid as usize]; + // println!("low={}, mid={}, high={}, mid_num={}, target={}", low, mid, high, mid_num, target); + if mid_num < target { + if mid == l - 1 || target <= nums[(mid+1) as usize] { + return mid; + } + low = mid + 1; + } else { + high = mid - 1; + } + } + -1 + } + + pub fn last_le(nums: Vec, target: i32) -> i32 { + let mut low = 0i32; + let mut high = (nums.len() - 1) as i32; + let l = nums.len() as i32; + while low <= high { + let mid = (low + high) / 2; + let mid_num = nums[mid as usize]; + // println!("low={}, mid={}, high={}, mid_num={}, target={}", low, mid, high, mid_num, target); + if mid_num <= target { + if mid == l - 1 || target < nums[(mid+1) as usize] { + return mid; + } + low = mid + 1; + } else { + high = mid - 1; + } + } + -1 + } +} + +// Use vector to represent a heap so that any element can be randomly accessed, but the element count must be fixed. +use std::cmp::Ordering; +#[derive(Debug)] +pub struct VecHeap{ + elements: Vec<(K,W,V)>, + key2idx: HashMap, +} + +impl VecHeap{ + + pub fn new(keys: Vec, weights : Vec, values : Vec) -> VecHeap { + let mut vh = VecHeap{elements: vec![], key2idx: HashMap::new()}; + let n = keys.len(); + for i in 0..keys.len() { + let idx = vh.elements.len(); + vh.key2idx.insert(keys[i].clone(), idx); + vh.elements.push((keys[i].clone(), weights[i].clone(), values[i].clone())); + } + + for i in (0..(n/2)).rev() { + vh.topdown_heapify(i, n); + } + + vh + } + + pub fn reweight_with_default(&mut self, key: &K, weight: &W, default_value: V) -> bool { + if let Some((k,w,v)) = self.remove(key) { + self.insert(k, weight.clone(),v); + true + } else { + self.insert(key.clone(), weight.clone(),default_value); + false + } + } + + pub fn reweight(&mut self, key: &K, weight: &W) -> bool { + if let Some((k,w,v)) = self.remove(key) { + self.insert(k, weight.clone(),v); + true + } else { + false + } + } + + pub fn remove(&mut self, key : &K) -> Option<(K,W,V)> { + if let Some(&removed_pos) = self.key2idx.get(key) { + // swap the removed element with the last element. + self.key2idx.remove(key); + if removed_pos == self.elements.len() - 1 { + self.elements.pop() + } else { + //swap the removed element wit the last. + let removed = self.elements[removed_pos].clone(); + let last_entry = self.elements.pop().unwrap(); + self.key2idx.insert(last_entry.0.clone(), removed_pos); + self.elements[removed_pos] = last_entry; + + // topdown_heapify from the removed pos + self.topdown_heapify(removed_pos, self.len()); + Some(removed) + } + + } else { + None + } + } + + pub fn insert(&mut self, key: K, weight: W, value: V) -> bool { + if self.key2idx.get(&key).is_none() { + let last_pos = self.elements.len(); + self.key2idx.insert(key.clone(), last_pos); + self.elements.push((key, weight, value)); + self.bottomup_heapify(last_pos); + true + } else { + false + } + + } + + pub fn bottomup_heapify(&mut self, start_pos : usize) { + if 0 < start_pos { + let parent_pos = (start_pos + 1) / 2 - 1; + if self.elements[parent_pos].1.cmp(&self.elements[start_pos].1) == Ordering::Less { + self.elements.swap(parent_pos, start_pos); + self.key2idx.insert(self.elements[start_pos].0.clone(), start_pos); + self.key2idx.insert(self.elements[parent_pos].0.clone(), parent_pos); + self.bottomup_heapify(parent_pos); + } + } + } + + pub fn topdown_heapify(&mut self, start_pos: usize, max_len: usize ) { + let left_pos = 2 * start_pos + 1; + let right_pos = 2 * (start_pos + 1); + + let mut large_pos = None; + let mut large_weight = self.elements[start_pos].1.clone(); + if left_pos < max_len && large_weight.cmp(&self.elements[left_pos].1) == Ordering::Less { + large_weight = self.elements[left_pos].1.clone(); + large_pos = Some(left_pos); + } + + if right_pos < max_len && large_weight.cmp(&self.elements[right_pos].1) == Ordering::Less { + large_weight = self.elements[right_pos].1.clone(); + large_pos = Some(right_pos); + } + + if let Some(large_pos) = large_pos { + self.elements.swap(start_pos, large_pos); + self.key2idx.insert(self.elements[start_pos].0.clone(), start_pos); + self.key2idx.insert(self.elements[large_pos].0.clone(), large_pos); + + self.topdown_heapify(large_pos, max_len); + } + } + + pub fn max(&self) -> Option<&(K,W,V)> { + self.elements.get(0) + } + + pub fn len(&self) -> usize { + self.elements.len() + } + +} + +use core::fmt::Debug; +pub fn heap_sort (nums: &mut Vec) { + let n = nums.len(); + let mut vh = VecHeap::new(nums.clone(), + nums.clone(), nums.clone()); + // println!("vh.elements={:?}", vh.elements); + // println!("vh.key2idx={:?}", vh.key2idx); + + for i in (0..n).rev() { + vh.elements.swap(0, i); + vh.topdown_heapify(0, i); + } + nums.clear(); + for entry in vh.elements { + nums.push(entry.0); + } +} + + +struct BitOp{} +impl BitOp { + pub fn zero_right_digits(x : i32, digit_count: usize) -> i32 { + x & (!0 << digit_count) + } + + pub fn nth_digit(x : i32, n : usize) -> i32 { + (x >> n) & 1 + } + // if n-th digit is 1, return 2^n, else 0. + // n starts from 0. + pub fn nth_digit_power(x : i32, n : usize) -> i32 { + x & (1 << n) + } + + pub fn set_nth_digit_one(x: i32, n: usize) -> i32 { + x | (1 << n) + } + + pub fn set_nth_digit_zero(x: i32, n: usize) -> i32 { + x & (!(1 << n)) + } + + // inclusive of nth + pub fn set_zero_from_nth(x: i32, n: usize) -> i32 { + x & ((1 << n) - 1) + } + + // inclusive of nth + pub fn set_zero_to_nth(x: i32, n: usize) -> i32 { + x & (!((1 << (n + 1)) - 1)) + } + + // set the least significant bit-1 to 0. + pub fn set_lsb1_zero(x: i32) -> i32 { + x & (x-1) + } + + // 2^(pos of lsb 1) + pub fn lsb1_power(x: i32) -> i32 { + x & -x + } + + pub fn digit1_count(mut x: i32) -> usize { + let mut count = 0; + while x != 0 { + x = Self::set_lsb1_zero(x); + count+=1; + } + count + } + + // the largest power of 2 le to x + pub fn largest_power(mut x : u32) -> u32 { + // println!("{:#032b}", x); + x = x | (x>>1); + // println!("{:#032b}", x); + x = x | (x>>2); + // println!("{:#032b}", x); + x = x | (x>>4); + // println!("{:#032b}", x); + x = x | (x>>8); + // println!("{:#032b}", x); + x = x | (x>>16); + // println!("{:#032b}", x); + x = (x+1)>>1; + // println!("{:#032b}", x); + x + } + + pub fn is_power_of_2(x : u32) -> bool { + x & (x-1) == 0 + } + + pub fn add(mut a : u32, mut b : u32) -> u32 { + while b != 0 { + let carry = a & b; + a = a ^ b; + b = carry << 1; + } + a + } + + pub fn divide(mut dividend : u32, divisor : u32) -> u32 { + let mut answer = 0u32; + while dividend >= divisor { + let mut base = divisor; + let mut cur_answer = 1u32; + while dividend >= base << 1 { + base = base << 1; + cur_answer = cur_answer << 1; + } + answer |= cur_answer; + dividend -= base; + } + answer + } +} +#[derive(Debug, Clone, Copy)] +struct StrUtil{} +impl StrUtil { + // transform a string to a char vec for a constant-time complexity to reference a i-th char. + pub fn str_to_char_vec(s : String) -> Vec { + s.chars().collect() + } + + pub fn char2idx(c : char) ->usize { + let base_idx = 'a' as u8 as usize; + let c_idx = c as u8 as usize; + c_idx - base_idx + } + + pub fn str2int(s : String) -> i32 { + s.parse::().unwrap() + } + + pub fn int2str(i : i32) -> String { + i.to_string() + } + + pub fn misc(s : String) { + let s : & str = &s[..]; + let sub : String = s[1..2].to_owned(); + + let mut hello = String::from("Hello, "); + hello.push('w'); // concat char + hello.push_str("orld!"); // append str + + let sentence: &'static str = "the quick brown fox jumps over the lazy dog"; + + // word typed as &str + for word in sentence.split_whitespace().rev() { + // println!("> {}", word); + } + + // Heap allocate a string + let alice = String::from("I like dogs"); + // Allocate new memory and store the modified string there + let bob: String = alice.replace("dog", "cat"); + + let ascii = 'a'; + let uppercase_a = 'A'; + let uppercase_g = 'G'; + let a = 'a'; + let g = 'g'; + let zero = '0'; + let percent = '%'; + let space = ' '; + let lf = '\n'; + let esc: char = 0x1b_u8.into(); + assert!(ascii.is_ascii()); + + assert!(uppercase_a.is_ascii_alphabetic()); + assert!(!zero.is_ascii_alphabetic()); + + assert!(zero.is_ascii_alphanumeric()); + assert!(!percent.is_ascii_alphanumeric()); + + assert!(!space.is_ascii_control()); + assert!(lf.is_ascii_control()); + + assert!(zero.is_ascii_digit()); + assert!(!percent.is_ascii_digit()); + + assert!(g.is_ascii_lowercase()); + assert!(!zero.is_ascii_lowercase()); + + assert!(!zero.is_ascii_punctuation()); + assert!(percent.is_ascii_punctuation()); + + assert_eq!(vec!["a".to_owned(), "b".to_owned()].join("-"), "a-b".to_owned()); + } +} + +struct TreeUtil {} +use std::rc::Rc; +use std::cell::RefCell; +use std::collections::VecDeque; +use crate::util::tree::{TreeNode, to_tree}; + +impl TreeUtil { + pub fn bfs(root: Option>>) -> Vec { + let mut traversed : Vec = vec![]; + if let Some(ref root_node) = root { + type NodeWithLevel = (Rc>, usize); + let mut queue : VecDeque = VecDeque::new(); + queue.push_back((Rc::clone(root_node), 1)); + + while let Some(head_entry) = queue.pop_front() { + let cur_node : Rc> = head_entry.0; + let cur_level : usize = head_entry.1; + traversed.push(cur_node.borrow().val); + // left_node typed with &Rc> + if let Some(left_node) = cur_node.borrow().left.as_ref() { + queue.push_back((Rc::clone(left_node), cur_level+1)); + }; + + // right_node typed with &Rc> + if let Some(right_node) = cur_node.borrow().right.as_ref() { + queue.push_back((Rc::clone(right_node), cur_level+1)); + }; + } + } + + traversed + } + + pub fn preorder(root: &Option>>) -> Vec { + if root.is_some() { + let mut r = vec![root.as_ref().unwrap().borrow().val]; + r.extend(Self::preorder(&root.as_ref().unwrap().borrow().left)); + r.extend(Self::preorder(&root.as_ref().unwrap().borrow().right)); + r + } else { + vec![] + } + } + + pub fn inorder(root: &Option>>) -> Vec { + if root.is_some() { + let mut r = vec![]; + r.extend(Self::preorder(&root.as_ref().unwrap().borrow().left)); + r.push(root.as_ref().unwrap().borrow().val); + r.extend(Self::preorder(&root.as_ref().unwrap().borrow().right)); + r + } else { + vec![] + } + } + + pub fn postorder(root: &Option>>) -> Vec { + if root.is_some() { + let mut r = vec![]; + r.extend(Self::preorder(&root.as_ref().unwrap().borrow().left)); + r.extend(Self::preorder(&root.as_ref().unwrap().borrow().right)); + r.push(root.as_ref().unwrap().borrow().val); + r + } else { + vec![] + } + } + + pub fn vec2bst_helper(nums : &[i32], size: i32) -> Option>> { + if size <= 0 { + None + } else { + // biase to left half so that mid will not overflow. + let mid = size / 2; + let left_size = mid; + let right_size = size - 1 - mid; + let node = Rc::new(RefCell::new(TreeNode::new(nums[mid as usize]))); + if 0 < mid { + node.borrow_mut().left = Self::vec2bst_helper(&nums[0..(mid as usize)], left_size); + } + + if mid+1 < size { + node.borrow_mut().right = Self::vec2bst_helper(&nums[(mid+1) as usize..], right_size); + } + Some(node) + } + } + + pub fn vec2bst(nums : Vec) -> Option>> { + Self::vec2bst_helper(&nums[..], nums.len() as i32) + } +} + + +struct VecUtil{} +impl VecUtil { + pub fn sort(v : &mut Vec) { + v.sort_by(|a : &i32,b: &i32|{a.cmp(b)}); + v.sort_by(|a,b|{ + if a < b { + return std::cmp::Ordering::Less; + } else if a == b { + return std::cmp::Ordering::Equal; + } else { + return std::cmp::Ordering::Greater; + } + }); + } + + pub fn range2vec(from_inclusive: i32, to_exclusive : i32) -> Vec { + (from_inclusive..to_exclusive).collect() + } + + pub fn incre_foreach(v : &mut Vec) { + v.iter_mut().for_each(|x : &mut i32|{*x+=1}) + } + + pub fn incre_foreach_to_vec(v: &Vec) -> Vec { + v.iter().map(|x : &i32|{x+1}).collect() + } + + pub fn stack() { + let mut s = vec![]; + s.push(0); + let e : Option = s.pop(); + } + + pub fn queue() { + use std::collections::VecDeque; + let mut q: VecDeque = VecDeque::new(); + q.push_back(0); + let e : Option = q.pop_front(); + } + + pub fn split() { + let mut a = vec![1,2,3]; + let b = a.split_off(1usize); + assert_eq!(a, vec![1]); + assert_eq!(b, vec![2,3]); + } + + pub fn iterator_misc() { + let mut xs = vec![0;100]; + let processed : Vec = xs.into_iter() + .skip(5) // skip the previous 5 elements + .filter(|x : &i32|{*x < 50}) // filter by a predicate + .take(10).collect(); // only consider the first 10. + + let _filter_by_idx : Vec = processed.iter().enumerate().filter(|&(idx, _)|{idx != 1}).map(|(_, &v)|{v}).collect(); + + + let e1 : Option<&i32> = processed.iter().next(); + let e10 : Option<&i32> = processed.iter().nth(10); + let last : Option<&i32> = processed.iter().last(); + let sum : i32 = processed.iter().sum(); + let count : usize = processed.iter().count(); + + let a1 = [1, 2, 3]; + let a2 = [4, 5, 6]; + + let mut iter = a1.iter().zip(a2.iter()); + + assert_eq!(iter.next(), Some((&1, &4))); + assert_eq!(iter.next(), Some((&2, &5))); + assert_eq!(iter.next(), Some((&3, &6))); + assert_eq!(iter.next(), None); + + + let a = ["1", "two", "NaN", "four", "5"]; + // Filter_map: The returned iterator yields only the values for which the supplied closure returns Some(value). + let mut iter = a.iter().filter_map(|s| s.parse().ok()); + + assert_eq!(iter.next(), Some(1)); + assert_eq!(iter.next(), Some(5)); + assert_eq!(iter.next(), None); + + let words = ["alpha", "beta", "gamma"]; + // Flat_map: Creates an iterator that works like map, but flattens nested structure. + let merged: String = words.iter() + .flat_map(|s| s.chars()) + .collect(); + assert_eq!(merged, "alphabetagamma".to_owned()); + + let a = [1, 2, 3]; + + let (even, odd): (Vec, Vec) = a + .iter() + .partition(|&n| n % 2 == 0); + + assert_eq!(even, vec![2]); + assert_eq!(odd, vec![1, 3]); + + // Fold + let a = [1, 2, 3]; + let sum = a.iter().fold(0, |acc : i32, x : &i32| {acc + x}); + assert_eq!(sum, 6); + + // All/any: Tests if every/any element of the iterator matches a predicate. + let a = [1, 2, 3]; + assert!(a.iter().all(|x : &i32| *x > 0)); + assert!(a.iter().any(|x : &i32| *x > 0)); + + // Find: find an element idx from left + // position/rposition: right the element index + let a = [1, 2, 3, 2]; + assert_eq!(a.iter().find(|x : &&i32| **x == 2), Some(&2)); + assert_eq!(a.iter().position(|x : &i32| *x == 2), Some(1usize)); + assert_eq!(a.iter().rposition(|x : &i32| *x == 2), Some(3usize)); + + let m : Option<&i32> = a.iter().max(); // min or max_by_key, max_by + assert_eq!(m, Some(&3)); + } + + pub fn misc() { + let mut xs = vec![1i32, 2, 3]; + + // Insert new element at the end of the vector + xs.push(4); + assert_eq!(xs, vec![1,2,3,4]); + + // The `len` method yields the number of elements currently stored in a vector + assert_eq!(xs.len(), 4); + + // Indexing is done using the square brackets (indexing starts at 0) + assert_eq!(xs[1], 2); + + // `pop` removes the last element from the vector and returns it + assert_eq!(xs.pop(), Some(4)); + + // `Vector`s can be easily iterated over + // println!("Contents of xs:"); + // x typed as &i32 + for x in xs.iter() { + // println!("> {}", x); + } + + // x typed as &mut i32 + for x in xs.iter_mut() { + *x +=1; + } + + // A `Vector` can also be iterated over while the iteration + // count is enumerated in a separate variable (`i`) + // i typed as usize. x typed as &i32 + for (i, x) in xs.iter().enumerate() { + // println!("In position {} we have value {}", i, x); + } + } +} + +struct MapUtil{} +impl MapUtil { + pub fn hashmap_misc() { + let mut map : HashMap = HashMap::new(); + let k1 = String::from("k1"); + let v1 = String::from("v1"); + let prev_val : Option =map.insert(k1, v1); // k1, v1 is consumed here. + assert_eq!(prev_val, None); + + // map.insert(k1,v1); illegal. + let k1 = String::from("k1"); + let v1 = String::from("v11"); + let prev_val : Option =map.insert(k1, v1); // k1, v1 is consumed here. + assert_eq!(prev_val, Some(String::from("v1"))); + + let k1 = String::from("k1"); + let v1 = String::from("v11"); + assert_eq!(map[&k1], v1); + + // basic + let mut map = HashMap::new(); + map.insert(1, "a".to_owned()); + map.insert(2, "b".to_owned()); + map.insert(3, "c".to_owned()); + assert_eq!(map.get(&1), Some(&"a".to_owned())); + assert_eq!(map.get(&4), None); + + assert_eq!(map.contains_key(&1), true); + assert_eq!(map.contains_key(&4), false); + + // insert with default + *(map.entry(5).or_insert("d".to_owned()))= "dd".to_owned(); + assert_eq!(map.get(&5), Some(&"dd".to_owned())); + + if let Some(x) = map.get_mut(&1) { + *x = "b".to_owned(); + } + assert_eq!(map[&1], "b".to_owned()); + // iteration: + // key typed as &i32, value typed as &String + for key in map.keys() { + // println!("{}", key); + } + + for val in map.values_mut() { + *val = "asd".to_owned(); + } + + for val in map.values() { + // println!("{}", val); + } + + for (key, val) in map.iter() { + // println!("key: {} val: {}", key, val); + } + + for (_, val) in map.iter_mut() { + *val = "asd".to_owned(); + } + assert_eq!(map.remove_entry(&1), Some((1, "asd".to_owned()))); + assert_eq!(map.remove(&1), None); + map.clear(); + + } + + pub fn orderedmap_misc() { + use std::ops::Bound::Included; + let mut om : BTreeMap = BTreeMap::new(); + om.insert("k1".to_owned(), "v1".to_owned()); + om.insert("k2".to_owned(), "v2".to_owned()); + + // the smallest entry + assert_eq!(om.iter().next(), Some((&"k1".to_owned(), &"v1".to_owned()))); + + // the greatest entry + assert_eq!(om.iter().next_back(), Some((&"k2".to_owned(), &"v2".to_owned()))); + + let mut map = BTreeMap::new(); + map.insert(3, "a".to_owned()); + map.insert(5, "b".to_owned()); + map.insert(8, "c".to_owned()); + + use std::ops::Range; // [start, end) + use std::ops::RangeInclusive; // [start, end] + + use std::ops::RangeTo; // (-inf, end) + use std::ops::RangeToInclusive; // (-inf, end] + use std::ops::RangeFrom; // [start, +inf) + use std::ops::RangeFull; // [-inf, +inf] + // key, value typed with & + // for (key, value) in map.range(Range{start:3, end:7}) { + for (key, value) in map.range(RangeInclusive::new(3, 5)) { + println!("{}: {}", key, value); + } + + for (key, value) in map.range_mut(RangeFull) { + // *key = 1; key is always immutable. + *value = "d".to_owned(); + // println!("{}: {}", key, value); + } + + // last key less + assert_eq!(map.range(RangeTo{end : 5}).next_back(), Some((&3, &"d".to_owned()))); + + // last key less or equal to + assert_eq!(map.range(RangeToInclusive{end : 5}).next_back(), Some((&5, &"d".to_owned()))); + + // first key greater or equal to + assert_eq!(map.range(RangeFrom{start : 7}).next(), Some((&8, &"d".to_owned()))); + assert_eq!(map.range(RangeFrom{start : 8}).next(), Some((&8, &"d".to_owned()))); + assert_eq!(map.range(RangeFrom{start : 9}).next(), None); + } + + pub fn hashset_misc() { + use std::collections::HashSet; + // Type inference lets us omit an explicit type signature (which + // would be `HashSet` in this example). + let mut books = HashSet::new(); + + // Add some books. + books.insert("A Dance With Dragons".to_string()); + books.insert("To Kill a Mockingbird".to_string()); + books.insert("The Odyssey".to_string()); + books.insert("The Great Gatsby".to_string()); + + // Check for a specific one. + assert!(!books.contains("The Winds of Winter")); + + // Remove a book. + assert!(books.remove("The Odyssey")); + assert!(!books.remove("The Odyssey")); + + // book typed with &String + for book in books.iter() { + // println!("{}", book); + } + } + + pub fn orderedset_misc() { + use std::collections::BTreeSet; + use std::ops::Bound::Included; + + let mut set = BTreeSet::new(); + set.insert(3); + set.insert(8); + set.insert(5); + // elem typed with & + for elem in set.range((Included(&4), Included(&8))) { + // println!("{}", elem); + } + assert_eq!(Some(&5), set.range(4..).next()); + // first and last + assert_eq!(set.iter().next(), Some(&3)); + assert_eq!(set.iter().next_back(), Some(&8)); + + + // Fast Init + let a: HashSet = [1, 2, 3].iter().cloned().collect(); + let b: HashSet = [4, 2, 3, 4].iter().cloned().collect(); + + // Can be seen as `a - b`. + // x typed as & + for x in a.difference(&b) { + // println!("{}", x); // Print 1 + } + + let diff: HashSet = a.difference(&b).cloned().collect(); + assert_eq!(diff, [1].iter().cloned().collect()); + + // Note that difference is not symmetric, + // and `b - a` means something else: + // no cloned to get a set of reference. + let diff: HashSet<&i32> = b.difference(&a).collect(); + assert_eq!(diff, [4].iter().collect()); + + let intersection: HashSet = a.intersection(&b).cloned().collect(); + assert_eq!(intersection, [2,3].iter().cloned().collect()); + + let union: HashSet = a.union(&b).cloned().collect(); + assert_eq!(union, [1,2,3,4].iter().cloned().collect()); + assert!(!a.is_subset(&b)); + assert!(!a.is_superset(&b)); + + } +} +struct Util(i32, i32); +impl Util { + pub fn option() { + let mut op : Option = None; + op = Some(1); + let op_ref : Option<&i32> = op.as_ref(); + let op_mref : Option<&mut i32> = op.as_mut(); + let op1 : Option = op.take(); // now op is None + let none_vec : Vec> = (0..26).map(|_| None).collect(); + + const NONE: Option = None; + let none_array : [Option;3] = [NONE;3]; + } + + pub fn input() { + let mut guess = String::new(); + + std::io::stdin() + .read_line(&mut guess) + .expect("Failed to read line"); + } + + pub fn unnamed_struct() { + let mut u : Util = Util(1,2); + assert_eq!(u.0, 1); + assert_eq!(u.1, 2); + u.0 = 3; + } + + pub fn pair() { + let p : (i32, i32) = (2,3); + assert_eq!(p.0, 1); + assert_eq!(p.1, 2); + } +} + +use crate::util::linked_list::{ListNode, to_list}; +struct ListUtil{} +impl ListUtil { + // traversal + pub fn list_size(head: Option>) -> usize { + let mut node : &Option> = &head; + let mut l = 0usize; + while node.is_some() { + node = &node.as_ref().unwrap().next; + l+=1; + } + l + } + + // Manipulate by list heads. assume l1.size - l2.size <=1 + pub fn take_turn_merge(l1: Option>,l2: Option>) -> Option> { + match((l1,l2)) { + (Some(mut l1_node), Some(mut l2_node))=>{ + l1_node.next = Self::take_turn_merge(Some(l2_node), l1_node.next); + Some(l1_node) + }, + (Some(l1_node), None)=>{ Some(l1_node) }, + (None, None)=>{ None} + (None, Some(l2_node))=>{panic!("Impossible...")} + } + } + + // Manipulate by list heads. + pub fn reverse_list(head: Option>) -> Option> { + let mut reversed = None; + let mut unreversed = head; + while let Some(mut unreversed_node) = unreversed { + unreversed = unreversed_node.next; + unreversed_node.next = reversed; + reversed = Some(unreversed_node); + } + + reversed + } + + // Manipulate by mutable references + pub fn remove_1st(node: &mut Option>) { + //Since mutable references can not move a variable completely or partially, we have to use take() to retrieve the next node, while leaving Null the original next field. + node.as_mut().unwrap().next = node.as_mut().unwrap().next.as_mut().unwrap().next.take(); + } +} + +struct MathUtil{} +impl MathUtil { + pub fn gcd(a:i32, b:i32) -> i32 {if b==0 {a} else {Self::gcd(b, a%b)}} + pub fn checked_op(a : i32, b : i32) -> Option{ + a.checked_mul(b) + } + + pub fn multi(a : i32, b : i32) { + i32::pow(a,b as u32); + usize::pow(a as usize,b as u32); + } + + pub fn rand_i32() -> i32{ + use rand::Rng; + let mut rng = rand::thread_rng(); + rng.gen::() + } + + pub fn rand_f64range() -> f64 { + use rand::Rng; + let mut rng = rand::thread_rng(); + rng.gen_range(0.0, 1.0) + } +} + +struct BacktrackUtil{} +impl BacktrackUtil { + pub fn permute(mut elements : Vec, no_dup : bool ) -> Vec> { + let mut result : Vec> = vec![]; + let n = elements.len(); + if n == 1 { + result.push(vec![elements[0]]); + } + let mut processed : HashSet = HashSet::new(); + for i in 0..n { + if processed.contains(&elements[i]) { + continue; + } + processed.insert(elements[i]); + elements.swap(0, i); + let sub_elements : Vec = elements.iter().cloned().skip(1).take(n-1).collect(); + let prev_perms : Vec> = Self::permute(sub_elements, no_dup); + for prev_perm in prev_perms { + let mut my_perm : Vec = vec![elements[0]]; + my_perm.extend(prev_perm.clone()); + result.push(my_perm); + } + + elements.swap(i, 0); + } + // println!("elements={:?}, result={:?}", elements,result); + result + } + + pub fn backtrack_helper(result : &mut Vec>, tmp : &mut Vec, elements : &Vec, predicate: P, parse: B, start : usize, no_dup : bool, element_reusable : bool) where P:Fn(&Vec>, &Vec)->(bool, bool) + Copy, B:Fn(&Vec,usize,usize)->Option + Copy, R:Clone +Eq + std::fmt::Debug, E:std::fmt::Debug{ + // is_sorted() is only supported in nightly-built rust + // if no_dup && !elements.is_sorted() { + // panic!("Elements must be presorted to deduplicate."); + // } + if no_dup && element_reusable { + panic!("element_reusable and no_dup can NOT be both on. "); + } + let (valid , early_stop) = predicate(result, tmp); + if valid { result.push(tmp.clone()); } + if early_stop {return} + + let n : usize = elements.len(); + let mut last_parsed : Option = None; + let mut start_parse_idx : usize = start; + for i in start..n { + let parsed : Option = parse(elements, start, i); + // println!("elements={:?}, start_idx={}, end={}, parsed={:?}", elements, start, i, parsed); + if parsed.is_none() { + continue; + } + let parsed : R = parsed.unwrap(); + + let mut backtrack = true; + if no_dup && last_parsed.is_some() && last_parsed.as_ref().unwrap().eq(&parsed) { + backtrack = false; + } + + if backtrack { + tmp.push(parsed.clone()); + let next_start = if element_reusable { start_parse_idx} else { i+1 }; + Self::backtrack_helper(result, tmp, elements, predicate, parse, next_start, no_dup, element_reusable); + tmp.pop(); + + } + last_parsed = Some(parsed.clone()); + start_parse_idx = i + 1; + } + } + + pub fn combine(mut elements : Vec, k : usize, no_dup : bool) -> Vec>{ + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let element_reusable = false; + if no_dup {elements.sort()} + + let predicate = |result: &Vec>, tmp : &Vec|{ + let mut valid = false; + let mut early_stop = false; + if tmp.len() > k { + early_stop = true; + } else if tmp.len() == k { + valid = true; + } + (valid, early_stop) + }; + + // start_idx and end_idx are both inclusive + let parse = |elements : &Vec, start_idx : usize, end_idx : usize|{ + Some(elements[end_idx]) + }; + + Self::backtrack_helper(&mut result, &mut tmp, &elements, predicate, parse, 0, no_dup, element_reusable); + result + } + + pub fn subsets(mut nums: Vec, no_dup : bool) -> Vec> { + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let element_reusable = false; + + let predicate = |result: &Vec>, tmp : &Vec|{ + let valid = true; + let early_stop = false; + (valid, early_stop) }; + let parse = |elements : &Vec, start_idx : usize, end_idx : usize|{ + Some(elements[end_idx]) + }; + + Self::backtrack_helper(&mut result, &mut tmp, &nums, predicate, parse, 0, no_dup, element_reusable); + result + } + + pub fn combination_sum(candidates: Vec, target: i32, element_reusable : bool) -> Vec> { + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let no_dup = false; + + let predicate = |result: &Vec>, tmp : &Vec|{ + let mut valid = false; + let mut early_stop = false; + let sum : i32 = tmp.iter().sum(); + if sum > target { + early_stop = true; + } + + if sum == target { + valid = true; + early_stop = true; + } + (valid, early_stop) + }; + let parse = |elements : &Vec, start_idx : usize, end_idx : usize|{ + Some(elements[end_idx]) + }; + + Self::backtrack_helper(&mut result, &mut tmp, &candidates, predicate, parse, 0, no_dup, element_reusable); + result + } + + pub fn partition(s: String) -> Vec> { + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let element_reusable = false; + let no_dup = false; + + let predicate = |result: &Vec>, tmp : &Vec|{ + let early_stop = false; + let mut l = 0usize; + for t in tmp.iter() { + l+=t.len(); + } + (l==s.len(), early_stop) + }; + + let parse = |elements : &Vec, start_idx : usize, end_idx : usize|{ + // end_idx is inclusive + let chars : Vec = elements.iter().skip(start_idx).take(end_idx + 1 - start_idx).cloned().collect(); + let n = chars.len(); + for i in 0..n/2 { + if chars[i] != chars[n-1-i] {return None} + } + let parsed : String = chars.into_iter().collect(); + Some(parsed) + }; + + let elements : Vec = s.chars().collect(); + Self::backtrack_helper(&mut result, &mut tmp, &elements, predicate, parse, 0, no_dup, element_reusable); + result + } + + pub fn combine_dp(n: i32, k: i32) -> Vec> { + let n = n as usize; + let k = k as usize; + let mut all : Vec>> = vec![vec![vec![]]; k+1]; + + for ni in 1..=n { + // (1..i as i32).collect(); + all[0] = vec![vec![]]; + for ki in (1..=k as usize).rev() { + if ki == ni { + all[ni] = vec![(1..=ni as i32).collect()]; + + } else if ki < ni { + // println!("\tki={}, ni={}, all[ki-1] = {:?}", ki, ni, all[ki-1]); + for mut prev_comb in all[ki-1].clone() { + prev_comb.push(ni as i32); + // println!("\tki={}, ni={}, prev_comb = {:?}", ki, ni, prev_comb); + all[ki].push(prev_comb); + } + + } else { + // n < ki => invalid case, ignore. + } + } + // println!("ni={}, {:?}", ni, all); + } + all[k].clone() + } + + pub fn track(board: &Vec>, i : i32, j : i32, target : &String, visited: &mut HashSet<(i32,i32)>) -> bool{ + if target.len() == 0 {return true;} + let target_char : char = target.chars().nth(0).unwrap(); + let row_count : i32 = board.len() as i32; + let col_count : i32 = board[0].len() as i32; + let mut found = false; + if (!visited.contains(&(i,j)) && 0 <= i && i < row_count && 0 <= j && j < col_count && board[i as usize][j as usize] == target_char) { + let next_target : String = String::from(&target[1..]); + visited.insert((i,j)); + found = Self::track(board, i-1, j, &next_target, visited) || + Self::track(board, i+1, j, &next_target, visited) || + Self::track(board, i, j-1, &next_target, visited) || + Self::track(board, i, j+1, &next_target, visited); + visited.remove(&(i,j)); + } + + found + } +} + + +// use BTreeMap key as the heap's weight. +struct BTreeMapAsHeap{} + +impl BTreeMapAsHeap { + pub fn push(heap : &mut BTreeMap>, key : i32, val : i32){ + heap.entry(key).or_insert(vec![]).push(val); + } + + pub fn min(heap : &BTreeMap>) -> Option<(i32, i32)> { + if let Some((&max_key, values)) = heap.iter().next() { + Some((max_key, *values.last().unwrap())) + } else { + None + } + } + + pub fn max(heap : &BTreeMap>) -> Option<(i32, i32)> { + if let Some((&max_key, values)) = heap.iter().next_back() { + Some((max_key, *values.last().unwrap())) + } else { + None + } + } + + pub fn pop_max(heap : &mut BTreeMap>) -> Option<(i32, i32)> { + if let Some((&max_key, _)) = heap.iter().next_back() { + let val : i32 = heap.get_mut(&max_key).unwrap().pop().unwrap(); + if heap[&max_key].len() == 0 {heap.remove(&max_key);} + Some((max_key, val)) + } else { + None + } + } + + pub fn pop_min(heap : &mut BTreeMap>) -> Option<(i32, i32)> { + if let Some((&min_key, _)) = heap.iter().next() { + let val : i32 = heap.get_mut(&min_key).unwrap().pop().unwrap(); + if heap[&min_key].len() == 0 {heap.remove(&min_key);} + Some((min_key, val)) + } else { + None + } + } +} + + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + #[test] + fn test_permcombsubset() { + assert_eq!(BacktrackUtil::permute(vec![0,1], false), vec![vec![0,1],vec![1,0]]); + + assert_eq!(BacktrackUtil::permute(vec![1,1,2], true), vec![vec![1,1, 2],vec![1,2,1],vec![2,1,1]]); + + assert_eq!(BacktrackUtil::combine(vec![1,2,2,4], 2, false), vec![vec![1,2],vec![1,2],vec![1,4],vec![2,2],vec![2,4],vec![2,4]]); + + assert_eq!(BacktrackUtil::combine(vec![1,2,2,4], 2, true), vec![vec![1,2],vec![1,4],vec![2,2],vec![2,4]]); + + assert_eq!( + BacktrackUtil::subsets(vec![1, 2, 2], false), + vec![ + vec![], + vec![1], + vec![1, 2], + vec![1, 2, 2], + vec![1, 2], + vec![2], + vec![2, 2], + vec![2], + ] + ); + + assert_eq!( + BacktrackUtil::subsets(vec![1, 2, 2], true), + vec![ + vec![], + vec![1], + vec![1, 2], + vec![1, 2, 2], + vec![2], + vec![2, 2], + ] + ); + + assert_eq!( + BacktrackUtil::combination_sum(vec![1, 1, 1, 1, 1, 1, 1], 7,false), + vec![vec![1, 1, 1, 1, 1, 1, 1]] + ); + + assert_eq!( + BacktrackUtil::combination_sum(vec![1], 7,true), + vec![vec![1, 1, 1, 1, 1, 1, 1]] + ); + + assert_eq!( + BacktrackUtil::partition("aab".to_owned()), + vec![ vec_string!["a", "a", "b"],vec_string!["aa", "b"],] + ); + assert_eq!( + BacktrackUtil::partition("aaa".to_owned()), + vec![ + vec_string!["a", "a", "a"], + vec_string!["a", "aa"], + vec_string!["aa", "a"], + vec_string!["aaa"], + ] + ); + } + + #[test] + fn test_tree() { + assert_eq!(TreeUtil::bfs(tree![1, 2, 2, 3, 4, 4, 3]), vec![1, 2, 2, 3, 4, 4, 3]); + + assert_eq!(TreeUtil::bfs(tree![1, 2, 2, null, 3, null, 3]), vec![1, 2, 2, 3, 3]); + + assert_eq!(TreeUtil::preorder(&tree![1, 2, 3, 4, null, null, 6]), vec![1, 2, 4, 3, 6]); + assert_eq!(TreeUtil::inorder(&tree![1, 2, 3, 4, null, null, 6]), vec![4, 2, 1, 3, 6]); + assert_eq!(TreeUtil::postorder(&tree![1, 2, 3, 4, null, null, 6]), vec![6, 3, 1, 2, 4]); + } + + #[test] + fn test_list() { + assert_eq!(ListUtil::list_size(linked![1, 2, 3, 4, 5]), 5); + assert_eq!(ListUtil::take_turn_merge(linked![1, 3, 5], linked![2, 4]), linked![1, 2, 3, 4, 5]); + assert_eq!(ListUtil::take_turn_merge(linked![1, 3, 5], linked![2, 4, 6]), linked![1, 2, 3, 4, 5, 6]); + assert_eq!( ListUtil::reverse_list(linked![1, 2, 3, 4, 5]), linked![5, 4, 3, 2, 1]); + let mut l = linked![1, 2, 3, 4, 5]; + ListUtil::remove_1st(&mut l); + assert_eq!(l, linked![1,3,4,5]); + } + + #[test] + fn test_bitop() { + + assert_eq!(BitOp::largest_power(9), 8); + assert_eq!(BitOp::zero_right_digits(7, 1), 6); + assert_eq!(BitOp::zero_right_digits(8, 2), 8); + assert_eq!(BitOp::zero_right_digits(-3, 2), -4); + + assert_eq!(BitOp::nth_digit(-3, 0), 1); + assert_eq!(BitOp::nth_digit(-3, 1), 0); + + assert_eq!(BitOp::nth_digit_power(-3, 1), 0); + assert_eq!(BitOp::nth_digit_power(5, 2), 4); + + assert_eq!(BitOp::set_nth_digit_zero(5, 2), 1); + assert_eq!(BitOp::set_nth_digit_one(5, 1), 7); + + assert_eq!(BitOp::set_zero_from_nth(5, 1), 1); + assert_eq!(BitOp::set_zero_from_nth(5, 3), 5); + assert_eq!(BitOp::set_zero_from_nth(-3, 3), 5); + assert_eq!(BitOp::set_zero_from_nth(-3, 4), 13); + + assert_eq!(BitOp::set_zero_to_nth(5, 0), 4); + assert_eq!(BitOp::set_zero_to_nth(5, 3), 0); + + assert_eq!(BitOp::set_zero_to_nth(-3, 2), -8); + assert_eq!(BitOp::set_lsb1_zero(5), 4); + assert_eq!(BitOp::set_lsb1_zero(6), 4); + + assert_eq!(BitOp::lsb1_power(6), 2); + assert_eq!(BitOp::lsb1_power(7), 1); + assert_eq!(BitOp::lsb1_power(8), 8); + assert!(BitOp::is_power_of_2(8)); + assert!(!BitOp::is_power_of_2(7)); + assert_eq!(BitOp::add(0,5), 5); + assert_eq!(BitOp::add(3,5), 8); + assert_eq!(BitOp::add(3,15), 18); + assert_eq!(BitOp::divide(3,15), 0); + assert_eq!(BitOp::divide(15,15), 1); + assert_eq!(BitOp::divide(15,3), 5); + assert_eq!(BitOp::divide(15,4), 3); + } + #[test] + fn test_heap() { + + let mut r = vec![12,11,13,5,6,7]; + heap_sort(&mut r); + assert_eq!(r, vec![5,6,7,11,12,13]); + + let k1 = String::from("k1"); + let k2 = String::from("k2"); + let k3 = String::from("k3"); + let k4 = String::from("k4"); + + let mut vh = VecHeap::new(vec + ![k1.clone(),k2.clone(),k3.clone(),k4.clone()], + vec![1,2,3,4], + vec![k1.clone(),k2.clone(),k3.clone(),k4.clone()]); + + + assert_eq!(vh.max(), Some(&(k4.clone(), 4, k4.clone()))); + assert_eq!(vh.len(), 4); + + assert_eq!(vh.remove(&k3), Some((k3.clone(), 3, k3.clone()))); + assert_eq!(vh.len(), 3); + assert_eq!(vh.max(), Some(&(k4.clone(), 4, k4.clone()))); + + assert_eq!(vh.remove(&k4), Some((k4.clone(), 4, k4.clone()))); + assert_eq!(vh.len(), 2); + assert_eq!(vh.max(), Some(&(k2.clone(), 2, k2.clone()))); + + let k5 = String::from("k5"); + vh.insert(k5.clone(), 5, k5.clone()); + assert_eq!(vh.max(), Some(&(k5.clone(), 5, k5.clone()))); + assert_eq!(vh.len(), 3); + + assert!(vh.reweight(&k1, &10)); + assert_eq!(vh.max(), Some(&(k1.clone(), 10, k1.clone()))); + assert_eq!(vh.len(), 3); + + assert_eq!(vh.remove(&k5), Some((k5.clone(), 5, k5.clone()))); + assert_eq!(vh.remove(&k4), None); + assert_eq!(vh.remove(&k3), None); + assert_eq!(vh.remove(&k2), Some((k2.clone(), 2, k2.clone()))); + assert_eq!(vh.remove(&k1), Some((k1.clone(), 10, k1.clone()))); + assert_eq!(vh.len(), 0); + + assert!(!vh.reweight(&k1, &10)); + assert!(!vh.reweight_with_default(&k5, &5, k5.clone())); + assert_eq!(vh.max(), Some(&(k5.clone(), 5, k5.clone()))); + assert_eq!(vh.len(), 1); + } + + #[test] + fn test_binarysearch() { + assert_eq!(BinarySearch::first_equal(vec![1,1,3,3,5,5],0), -1); + assert_eq!(BinarySearch::first_equal(vec![1,1,3,3,5,5],1), 0); + assert_eq!(BinarySearch::first_equal(vec![1,1,3,3,5,5],2), -1); + assert_eq!(BinarySearch::first_equal(vec![1,1,3,3,5,5],3), 2); + assert_eq!(BinarySearch::first_equal(vec![1,1,3,3,5,5],5), 4); + assert_eq!(BinarySearch::first_equal(vec![1,1,3,3,5,5],7), -1); + + assert_eq!(BinarySearch::last_equal(vec![1,1,3,3,5,5],0), -1); + assert_eq!(BinarySearch::last_equal(vec![1,1,3,3,5,5],1), 1); + assert_eq!(BinarySearch::last_equal(vec![1,1,3,3,5,5],2), -1); + assert_eq!(BinarySearch::last_equal(vec![1,1,3,3,5,5],3), 3); + assert_eq!(BinarySearch::last_equal(vec![1,1,3,3,5,5],5), 5); + assert_eq!(BinarySearch::last_equal(vec![1,1,3,3,5,5],7), -1); + + assert_eq!(BinarySearch::first_gt(vec![1,1,3,3,5,5],2), 2); + assert_eq!(BinarySearch::first_gt(vec![1,1,3,3,5,5],3), 4); + assert_eq!(BinarySearch::first_gt(vec![1,1,3,3,5,5],5), -1); + assert_eq!(BinarySearch::first_gt(vec![1,1,3,3,5,5],7), -1); + + assert_eq!(BinarySearch::first_ge(vec![1,1,3,3,5,5],0), 0); + assert_eq!(BinarySearch::first_ge(vec![1,1,3,3,5,5],1), 0); + assert_eq!(BinarySearch::first_ge(vec![1,1,3,3,5,5],2), 2); + assert_eq!(BinarySearch::first_ge(vec![1,1,3,3,5,5],3), 2); + assert_eq!(BinarySearch::first_ge(vec![1,1,3,3,5,5],5), 4); + assert_eq!(BinarySearch::first_ge(vec![1,1,3,3,5,5],7), -1); + + assert_eq!(BinarySearch::last_lt(vec![1,1,3,3,5,5],0), -1); + assert_eq!(BinarySearch::last_lt(vec![1,1,3,3,5,5],1), -1); + assert_eq!(BinarySearch::last_lt(vec![1,1,3,3,5,5],2), 1); + assert_eq!(BinarySearch::last_lt(vec![1,1,3,3,5,5],3), 1); + assert_eq!(BinarySearch::last_lt(vec![1,1,3,3,5,5],5), 3); + assert_eq!(BinarySearch::last_lt(vec![1,1,3,3,5,5],7), 5); + + assert_eq!(BinarySearch::last_le(vec![1,1,3,3,5,5],0), -1); + assert_eq!(BinarySearch::last_le(vec![1,1,3,3,5,5],1), 1); + assert_eq!(BinarySearch::last_le(vec![1,1,3,3,5,5],2), 1); + assert_eq!(BinarySearch::last_le(vec![1,1,3,3,5,5],3), 3); + assert_eq!(BinarySearch::last_le(vec![1,1,3,3,5,5],5), 5); + assert_eq!(BinarySearch::last_le(vec![1,1,3,3,5,5],7), 5); + } + + #[test] + fn test_unionfind() { + let mut elements = HashSet::new(); + let e0 = "0".to_owned(); + let e1 = "1".to_owned(); + let e2 = "2".to_owned(); + let e3 = "3".to_owned(); + let e4 = "4".to_owned(); + let e5 = "5".to_owned(); + elements.insert(e0.clone()); + elements.insert(e1.clone()); + elements.insert(e2.clone()); + elements.insert(e3.clone()); + elements.insert(e4.clone()); + let mut uf = UnionFind::new_with(&elements); + assert_eq!(uf.max_subset_size, 1); + assert_eq!(uf.subset_count, 5); + assert_eq!(uf.parents[&e3], e3); + assert_eq!(uf.find(&e3), Some(e3.clone())); + assert_eq!(uf.find(&e5), None); + + // shall result like + // 0 2 3 4 + // - + // 1 + assert!(uf.union(&e0, &e1)); + assert_eq!(uf.max_subset_size, 2); + assert_eq!(uf.subset_count, 4); + assert_eq!(uf.parents[&e0], e0); + assert_eq!(uf.parents[&e1], e0); + assert_eq!(uf.find(&e1), Some(e0.clone())); + assert_eq!(uf.find(&e4), Some(e4.clone())); + + // shall result like + // 0 3 4 + // - - + // 1 2 + assert!(uf.union(&e3, &e2)); + assert_eq!(uf.max_subset_size, 2); + assert_eq!(uf.subset_count, 3); + assert_eq!(uf.parents[&e2], e3); + assert_eq!(uf.parents[&e3], e3); + assert_eq!(uf.find(&e2), Some(e3.clone())); + assert_eq!(uf.find(&e4), Some(e4.clone())); + + // shall result like + // 0 3 + // - - - + // 1 2 4 + assert!(uf.union(&e4, &e2)); + assert!(!uf.union(&e1, &e0)); + assert_eq!(uf.max_subset_size, 3); + assert_eq!(uf.subset_count, 2); + assert_eq!(uf.parents[&e2], e3); + assert_eq!(uf.parents[&e3], e3); + assert_eq!(uf.parents[&e4], e3); + + // shall result like + // 3 + // - - - + // 0 2 4 + // - + // 1 + assert!(uf.union(&e1, &e4)); + assert_eq!(uf.max_subset_size, 5); + assert_eq!(uf.subset_count, 1); + assert_eq!(uf.parents[&e0], e3); + assert_eq!(uf.parents[&e1], e0); + assert_eq!(uf.parents[&e2], e3); + assert_eq!(uf.find(&e1), Some(e3.clone())); + assert_eq!(uf.find(&e2), Some(e3.clone())); + assert_eq!(uf.find(&e4), Some(e3.clone())); + + assert_eq!(uf.find_along_compression(&e1), Some(e3.clone())); + // shall result like + // 3 + // - - - - + // 0 1 2 4 + assert_eq!(uf.parents[&e0], e3); + assert_eq!(uf.parents[&e1], e3); + assert_eq!(uf.parents[&e2], e3); + + assert!(!uf.union(&e3, &e4)); + + // shall result like + // 3 + // - - - - - + // 0 1 2 4 5 + assert!(uf.union(&e5, &e0)); // a new element 5 + assert_eq!(uf.subset_count, 1); + assert_eq!(uf.max_subset_size, 6); + assert_eq!(uf.parents[&e5], e3); + assert_eq!(uf.find(&e5), Some(e3.clone())); + + + + let mut uf = UnionFindInt::new(5); + assert_eq!(uf.max_subset_size, 1); + assert_eq!(uf.subset_count, 5); + assert_eq!(uf.find_root(3), 3); + assert_eq!(uf.find_root_with_compression(0), 0); + + // shall result like + // 0 2 3 4 + // - + // 1 + assert!(uf.union(0, 1)); + assert_eq!(uf.max_subset_size, 2); + assert_eq!(uf.subset_count, 4); + assert_eq!(uf.find_root(0), 0); + assert_eq!(uf.find_root(1), 0); + assert_eq!(uf.find_root(2), 2); + + // shall result like + // 0 3 4 + // - - + // 1 2 + assert!(uf.union(3, 2)); + assert_eq!(uf.max_subset_size, 2); + assert_eq!(uf.subset_count, 3); + assert_eq!(uf.find_root(3), 3); + assert_eq!(uf.find_root(4), 4); + assert_eq!(uf.find_root_with_compression(2), 3); + + // shall result like + // 0 3 + // - - - + // 1 2 4 + assert!(uf.union(4, 2)); + assert_eq!(uf.max_subset_size, 3); + assert_eq!(uf.subset_count, 2); + assert_eq!(uf.find_root(1), 0); + assert_eq!(uf.find_root(2), 3); + assert_eq!(uf.find_root(3), 3); + assert_eq!(uf.find_root(4), 3); + + // shall result like + // 3 + // - - - + // 0 2 4 + // - + // 1 + assert!(uf.union(1, 4)); + assert_eq!(uf.max_subset_size, 5); + assert_eq!(uf.subset_count, 1); + assert_eq!(uf.parents[1], 0); + assert_eq!(uf.find_root(1), 3); + assert_eq!(uf.find_root(0), 3); + assert_eq!(uf.find_root(2), 3); + assert_eq!(uf.find_root(4), 3); + + assert_eq!(uf.find_root_with_compression(1), 3); + // shall result like + // 3 + // - - - - + // 0 1 2 4 + assert_eq!(uf.max_subset_size, 5); + assert_eq!(uf.subset_count, 1); + assert_eq!(uf.parents[1], 3); + assert_eq!(uf.find_root(1), 3); + assert_eq!(uf.find_root(0), 3); + assert_eq!(uf.find_root(2), 3); + assert_eq!(uf.find_root(4), 3); + } + + #[test] + fn test_utils() { + MapUtil::hashmap_misc(); + MapUtil::orderedmap_misc(); + MapUtil::hashset_misc(); + MapUtil::orderedset_misc(); + VecUtil::iterator_misc(); + VecUtil::misc(); + } + + #[test] + fn test_binary_heap() { + use std::collections::BinaryHeap; + let mut max_heap : BinaryHeap = BinaryHeap::new(); + max_heap.push(10); + max_heap.push(20); + max_heap.push(2); + + assert_eq!(max_heap.pop(), Some(20)); + assert_eq!(max_heap.peek(), Some(&10)); + assert_eq!(max_heap.pop(), Some(10)); + assert_eq!(max_heap.pop(), Some(2)); + assert_eq!(max_heap.pop(), None); + + let max_heap : BinaryHeap = BinaryHeap::from(vec![1,2,3]); + assert_eq!(max_heap.peek(), Some(&3)); + } + +} diff --git a/src/problem/p0001_two_sum.rs b/src/problem/p0001_two_sum.rs new file mode 100644 index 00000000..d0e2b567 --- /dev/null +++ b/src/problem/p0001_two_sum.rs @@ -0,0 +1,70 @@ +/** + * [1] Two Sum + * + * Given an array of integers nums and an integer target, return indices of the two numbers such that they add up to target. + * You may assume that each input would have exactly one solution, and you may not use the same element twice. + * You can return the answer in any order. + * + * Example 1: + * + * Input: nums = [2,7,11,15], target = 9 + * Output: [0,1] + * Output: Because nums[0] + nums[1] == 9, we return [0, 1]. + * + * Example 2: + * + * Input: nums = [3,2,4], target = 6 + * Output: [1,2] + * + * Example 3: + * + * Input: nums = [3,3], target = 6 + * Output: [0,1] + * + * + * Constraints: + * + * 2 <= nums.length <= 10^3 + * -10^9 <= nums[i] <= 10^9 + * -10^9 <= target <= 10^9 + * Only one valid answer exists. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/two-sum/ +// discuss: https://leetcode.com/problems/two-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::collections::HashMap; + +impl Solution { + pub fn two_sum(nums: Vec, target: i32) -> Vec { + let mut num2idx = HashMap::new(); + for (idx, num) in nums.iter().enumerate() { + let diff = target - num; + if let Some(&diff_idx) = num2idx.get(&diff) { + return vec![diff_idx as i32, idx as i32]; + } else { + num2idx.insert(num, idx); + } + } + + // reverse.insert() + vec![] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_1() { + assert_eq!(vec![0, 1], Solution::two_sum(vec![2, 7, 11, 15], 9)); + assert_eq!(vec![1, 2], Solution::two_sum(vec![3, 2, 4], 6)); + } +} diff --git a/src/problem/p0003_longest_substring_without_repeating_characters.rs b/src/problem/p0003_longest_substring_without_repeating_characters.rs new file mode 100644 index 00000000..d46a0282 --- /dev/null +++ b/src/problem/p0003_longest_substring_without_repeating_characters.rs @@ -0,0 +1,94 @@ +/** + * [3] Longest Substring Without Repeating Characters + * + * Given a string s, find the length of the longest substring without repeating characters. + * + * Example 1: + * + * Input: s = "abcabcbb" + * Output: 3 + * Explanation: The answer is "abc", with the length of 3. + * + * Example 2: + * + * Input: s = "bbbbb" + * Output: 1 + * Explanation: The answer is "b", with the length of 1. + * + * Example 3: + * + * Input: s = "pwwkew" + * Output: 3 + * Explanation: The answer is "wke", with the length of 3. + * Notice that the answer must be a substring, "pwke" is a subsequence and not a substring. + * + * Example 4: + * + * Input: s = "" + * Output: 0 + * + * + * Constraints: + * + * 0 <= s.length <= 5 * 10^4 + * s consists of English letters, digits, symbols and spaces. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/longest-substring-without-repeating-characters/ +// discuss: https://leetcode.com/problems/longest-substring-without-repeating-characters/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; + +impl Solution { + pub fn length_of_longest_substring(s: String) -> i32 { + let (mut left, mut right) = (0usize, 0usize); + // The index of each char of current substr, + let mut exists: HashMap = HashMap::new(); + let mut max_len = 0; + + while let Some(right_char) = s.chars().nth(right) { + if let Some(&dup_pos) = exists.get(&right_char) { + // Identify a valid str, which starts at left inclusive and ends at right exclusive. + max_len = std::cmp::max(max_len, right - left); + + // Remove chars from left to dup_idx in exists. + for i in left..=dup_pos { + if let None = exists.remove(&s.chars().nth(i).unwrap()) { + panic!("Not found '{}' at exists when left = {}, right = {}", s.chars().nth(i).unwrap(), left, right); + } + } + left = dup_pos + 1; // left can be equal to right, which implies empty substr. + } + exists.insert(right_char, right); + // *exists.entry(right_char).or_insert().unwrap() = right; + right+=1; + } + + // now right points the end of str. + max_len = std::cmp::max(max_len, right - left); + max_len as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_3() { + assert_eq!( + Solution::length_of_longest_substring("abcabcbb".to_string()), + 3 + ); + assert_eq!(Solution::length_of_longest_substring("bbbb".to_string()), 1); + assert_eq!( + Solution::length_of_longest_substring("pwwkew".to_string()), + 3 + ); + } +} diff --git a/src/problem/p0004_median_of_two_sorted_arrays.rs b/src/problem/p0004_median_of_two_sorted_arrays.rs new file mode 100644 index 00000000..51f578c3 --- /dev/null +++ b/src/problem/p0004_median_of_two_sorted_arrays.rs @@ -0,0 +1,183 @@ +/** + * [4] Median of Two Sorted Arrays + * + * Given two sorted arrays nums1 and nums2 of size m and n respectively, return the median of the two sorted arrays. + * + * Example 1: + * + * Input: nums1 = [1,3], nums2 = [2] + * Output: 2.00000 + * Explanation: merged array = [1,2,3] and median is 2. + * + * Example 2: + * + * Input: nums1 = [1,2], nums2 = [3,4] + * Output: 2.50000 + * Explanation: merged array = [1,2,3,4] and median is (2 + 3) / 2 = 2.5. + * + * Example 3: + * + * Input: nums1 = [0,0], nums2 = [0,0] + * Output: 0.00000 + * + * Example 4: + * + * Input: nums1 = [], nums2 = [1] + * Output: 1.00000 + * + * Example 5: + * + * Input: nums1 = [2], nums2 = [] + * Output: 2.00000 + * + * + * Constraints: + * + * nums1.length == m + * nums2.length == n + * 0 <= m <= 1000 + * 0 <= n <= 1000 + * 1 <= m + n <= 2000 + * -10^6 <= nums1[i], nums2[i] <= 10^6 + * + * + * Follow up: The overall run time complexity should be O(log (m+n)). + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/median-of-two-sorted-arrays/ +// discuss: https://leetcode.com/problems/median-of-two-sorted-arrays/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_nth(nums1 : &Vec, start1 : usize, end1 : usize, + nums2: &Vec, start2 : usize, end2 : usize, n : usize, level : usize) -> i32 { + // let level_padding : String = (0..level).map(|_|{" "}).collect(); + let level_padding = ""; + // println!("{}start1={}, end1={}, start2={}, end2={}, n={}", level_padding, start1, end1, start2, end2, n); + + if start1 == end1 { + return nums2[start2 + n]; + } else if start2 == end2 { + return nums1[start1 + n]; + } else if n == 0 { + return std::cmp::min(nums1[start1], nums2[start2]); + } + + let mid1 : usize = std::cmp::min((n+1)/2, end1-start1); + let mid2 : usize = std::cmp::min((n+1)/2, end2-start2); + // println!("nums1[mid={}]={}, nums2[mid={}]={}", start1 + mid1-1,nums1[start1 + mid1-1], start2 +mid2-1, nums2[start2 + mid2-1]); + // note that mid1 + mid2 <= n. + if nums1[start1 + mid1-1] < nums2[start2 + mid2-1] { + // For any ni = nums1[i] such that 0<=i, start1 : usize, end1 : usize, + mut nums2: &Vec, start2 : usize, end2 : usize, n : usize, level : usize) -> i32 { + + let level_padding : String = (0..level).map(|_|{" "}).collect(); + let mut l1 : usize = end1 - start1; + let mut l2 : usize = end2 - start2; + if l1 < l2 { + return Self::find_nth(nums2, start2, end2, nums1, start1, end1, n,level); + } + + let mid1_num : i32 = nums1[start1 + n / 2]; + // println!("{}nums1={:?}, nums2={:?}", level_padding, nums1, nums2); + // println!("{}start1={}, end1={}, mid1_pos={}, mid1_num={}, start2={}, end2={},n={}", level_padding, start1, end1, start1 + n / 2, mid1_num, start2, end2, n); + // find the index of last smaller element in num2, -1 implies not found. + let mut mid2_pos : i32 = -1; + let mut low : i32 = 0; + let mut high : i32 = l2 as i32 - 1; + while low <= high { + let cur_mid : i32 = (high + low) / 2; + let cur_mid2_num : i32 = nums2[start2 + cur_mid as usize]; + // println!("{}low={}, high={}, cur_mid={}, cur_mid2_num={}", level_padding, low, high, cur_mid, cur_mid2_num); + if cur_mid2_num <= mid1_num { + if cur_mid as usize == l2 - 1 { + // println!("cur_mid={},l2={}",cur_mid,l2); + mid2_pos = cur_mid; + break; + } else if !(nums2[start2 + cur_mid as usize + 1] <= mid1_num) { + // find the target + mid2_pos = cur_mid; + break; + } else { + low = cur_mid + 1; + } + } else { + high = cur_mid - 1; + } + } + let mid1_num_le_count : usize = (mid2_pos + 1) as usize + n /2; + // println!("{}mid2_pos={}, mid1_num_le_count={}", level_padding,mid2_pos, mid1_num_le_count); + if mid1_num_le_count == n { + return mid1_num; + } else if mid1_num_le_count < n { + return Self::find_nth(nums1, start1 + n / 2 + 1, end1, nums2, start2 + (mid2_pos + 1) as usize, end2, n - 1 - mid1_num_le_count, level+1); + } else { + return Self::find_nth(nums1, start1, start1 + n / 2, nums2, start2, start2 + (mid2_pos + 1) as usize, n,level + 1); + } + } + pub fn find_median_sorted_arrays(nums1: Vec, nums2: Vec) -> f64 { + let l1 : usize = nums1.len(); + let l2 : usize = nums2.len(); + if (l1 + l2) % 2 == 1 { + let idx : usize = (l1 + l2 - 1) / 2; + let mid : i32 = Self::find_nth(&nums1, 0, l1, &nums2, 0, l2, idx,0); + println!("Odd {}-th = {}", idx, mid); + return mid as f64; + } else { + let idx : usize = (l1 + l2) / 2 - 1; + let smaller_mid : i32 = Self::find_nth(&nums1, 0, l1, &nums2, 0, l2, idx,0); + println!("Even {}-th = {}", idx, smaller_mid); + println!("======================================="); + + let idx : usize = (l1 + l2) / 2; + let larger_mid : i32 = Self::find_nth(&nums1, 0, l1, &nums2, 0, l2, idx,0); + println!("Even {}-th = {}", idx, larger_mid); + return (smaller_mid + larger_mid) as f64 / 2.0; + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_4() { + assert_eq!( + Solution::find_median_sorted_arrays(vec![1, 3], vec![2]), + 2.0 + ); + assert_eq!( + Solution::find_median_sorted_arrays(vec![1, 2], vec![3, 4]), + 2.5 + ); + + assert_eq!( + Solution::find_median_sorted_arrays(vec![1, 2], vec![1, 1]), + 1.0 + ); + + assert_eq!( + Solution::find_median_sorted_arrays(vec![1, 3], vec![2, 7]), + 2.5 + ); + + assert_eq!( + Solution::find_median_sorted_arrays(vec![1], vec![2, 3, 4]), + 2.5 + ); + } +} diff --git a/src/problem/p0005_longest_palindromic_substring.rs b/src/problem/p0005_longest_palindromic_substring.rs new file mode 100644 index 00000000..098e111c --- /dev/null +++ b/src/problem/p0005_longest_palindromic_substring.rs @@ -0,0 +1,103 @@ +/** + * [5] Longest Palindromic Substring + * + * Given a string s, return the longest palindromic substring in s. + * + * + * Example 1: + * + * + * Input: s = "babad" + * Output: "bab" + * Note: "aba" is also a valid answer. + * + * + * Example 2: + * + * + * Input: s = "cbbd" + * Output: "bb" + * + * + * Example 3: + * + * + * Input: s = "a" + * Output: "a" + * + * + * Example 4: + * + * + * Input: s = "ac" + * Output: "a" + * + * + * + * Constraints: + * + * + * 1 <= s.length <= 1000 + * s consist of only digits and English letters (lower-case and/or upper-case), + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/longest-palindromic-substring/ +// discuss: https://leetcode.com/problems/longest-palindromic-substring/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn longest_palindrome(s: String) -> String { + let mut longest_end_pos = 0usize; + let mut longest_len = 1usize; + let n : usize = s.len(); + let mut last_start_positions : Vec = vec![]; + + let s : Vec = s.chars().collect(); + for i in 0..n { + let mut this_start : Vec = vec![]; + this_start.push(i); + if 1 <= i { + if s[i-1] == s[i] { + this_start.push(i-1); + } + for &last_start_position in last_start_positions.iter() { + if 1 <= last_start_position && s[last_start_position - 1] == s[i] { + this_start.push(last_start_position - 1); + } + } + + } + for &start_pos in this_start.iter() { + let palindrome_len : usize = i - start_pos + 1; + // println!("end(i)={}, start_pos={}, palindrome_len={},longest_len={}", i, start_pos, palindrome_len,longest_len); + if palindrome_len > longest_len { + longest_len = palindrome_len; + longest_end_pos = i; + } + } + last_start_positions = this_start; + } + let start_pos : usize = longest_end_pos + 1 - longest_len ; // inclusive + s.iter().skip(start_pos).take(longest_len).collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_5() { + assert_eq!(Solution::longest_palindrome("aaaaa".to_owned()), "aaaaa"); + assert_eq!(Solution::longest_palindrome("babab".to_owned()), "babab"); + assert_eq!(Solution::longest_palindrome("babcd".to_owned()), "bab"); + assert_eq!(Solution::longest_palindrome("cbbd".to_owned()), "bb"); + assert_eq!(Solution::longest_palindrome("bb".to_owned()), "bb"); + assert_eq!(Solution::longest_palindrome("".to_owned()), ""); + } +} diff --git a/src/problem/p0006_zigzag_conversion.rs b/src/problem/p0006_zigzag_conversion.rs new file mode 100644 index 00000000..34385341 --- /dev/null +++ b/src/problem/p0006_zigzag_conversion.rs @@ -0,0 +1,117 @@ +/** + * [6] ZigZag Conversion + * + * The string "PAYPALISHIRING" is written in a zigzag pattern on a given number of rows like this: (you may want to display this pattern in a fixed font for better legibility) + * + * P A H N + * A P L S I I G + * Y I R + * + * And then read line by line: "PAHNAPLSIIGYIR" + * Write the code that will take a string and make this conversion given a number of rows: + * + * string convert(string s, int numRows); + * + * + * Example 1: + * + * Input: s = "PAYPALISHIRING", numRows = 3 + * Output: "PAHNAPLSIIGYIR" + * + * Example 2: + * + * Input: s = "PAYPALISHIRING", numRows = 4 + * Output: "PINALSIGYAHRPI" + * Explanation: + * P I N + * A L S I G + * Y A H R + * P I + * + * Example 3: + * + * Input: s = "A", numRows = 1 + * Output: "A" + * + * + * Constraints: + * + * 1 <= s.length <= 1000 + * s consists of English letters (lower-case and upper-case), ',' and '.'. + * 1 <= numRows <= 1000 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/zigzag-conversion/ +// discuss: https://leetcode.com/problems/zigzag-conversion/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn convert(s: String, row_count: i32) -> String { + if row_count == 1 {return s} + let row_count : usize = row_count as usize; + let s : Vec = s.chars().collect(); + let period : usize = 2*(row_count - 1); + + let period_count : usize = s.len() / period + 1; + let col_count : usize = period_count * (row_count - 1); + + let mut output : Vec> = vec![vec![' ';col_count];row_count]; + // println!("col_count : {}", col_count); + let mut char_pos : usize = 0; + for p in 0..period_count { + let mut cur_col : usize = p * (row_count - 1); + let mut cur_row : usize = 0; + while char_pos < s.len() && (cur_row as usize) < row_count { + // println!("P1: cur_row={},cur_col={}, char_pos={}, char={}", cur_row, cur_col, char_pos, s[char_pos]); + output[cur_row][cur_col] = s[char_pos]; + char_pos +=1; + cur_row +=1; + } + + cur_row = row_count - 2; + cur_col += 1; + while char_pos < s.len() && 0 < cur_row { + // println!("P2: cur_row={},cur_col={}, char_pos={}, char={}", cur_row, cur_col, char_pos, s[char_pos]); + + output[cur_row][cur_col] = s[char_pos]; + char_pos +=1; + cur_row -=1; + cur_col +=1; + } + } + + let mut result : Vec = vec![]; + for i in 0..row_count { + for j in 0..col_count { + if output[i][j] != ' ' { + result.push(output[i][j]); + } + } + } + result.iter().collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_6() { + assert_eq!( + Solution::convert("PAYPALISHIRING".to_string(), 4), + "PINALSIGYAHRPI" + ); + assert_eq!( + Solution::convert("PAYPALISHIRING".to_string(), 3), + "PAHNAPLSIIGYIR" + ); + assert_eq!(Solution::convert("A".to_string(), 1), "A"); + assert_eq!(Solution::convert("AY".to_string(), 2), "AY"); + } +} diff --git a/src/problem/p0008_string_to_integer_atoi.rs b/src/problem/p0008_string_to_integer_atoi.rs new file mode 100644 index 00000000..637a9c4e --- /dev/null +++ b/src/problem/p0008_string_to_integer_atoi.rs @@ -0,0 +1,178 @@ +/** + * [8] String to Integer (atoi) + * + * Implement the myAtoi(string s) function, which converts a string to a 32-bit signed integer (similar to C/C++'s atoi function). + * The algorithm for myAtoi(string s) is as follows: + *
    + * Read in and ignore any leading whitespace. + * Check if the next character (if not already at the end of the string) is '-' or '+'. Read this character in if it is either. This determines if the final result is negative or positive respectively. Assume the result is positive if neither is present. + * Read in next the characters until the next non-digit charcter or the end of the input is reached. The rest of the string is ignored. + * Convert these digits into an integer (i.e. "123" -> 123, "0032" -> 32). If no digits were read, then the integer is 0. Change the sign as necessary (from step 2). + * If the integer is out of the 32-bit signed integer range [-2^31, 2^31 - 1], then clamp the integer so that it remains in the range. Specifically, integers less than -2^31 should be clamped to -2^31, and integers greater than 2^31 - 1 should be clamped to 2^31 - 1. + * Return the integer as the final result. + *
+ * Note: + * + * Only the space character ' ' is considered a whitespace character. + * Do not ignore any characters other than the leading whitespace or the rest of the string after the digits. + * + * + * Example 1: + * + * Input: s = "42" + * Output: 42 + * Explanation: The underlined characters are what is read in, the caret is the current reader position. + * Step 1: "42" (no characters read because there is no leading whitespace) + * ^ + * Step 2: "42" (no characters read because there is neither a '-' nor '+') + * ^ + * Step 3: "42" ("42" is read in) + * ^ + * The parsed integer is 42. + * Since 42 is in the range [-2^31, 2^31 - 1], the final result is 42. + * + * Example 2: + * + * Input: s = " -42" + * Output: -42 + * Explanation: + * Step 1: " -42" (leading whitespace is read and ignored) + * ^ + * Step 2: " -42" ('-' is read, so the result should be negative) + * ^ + * Step 3: " -42" ("42" is read in) + * ^ + * The parsed integer is -42. + * Since -42 is in the range [-2^31, 2^31 - 1], the final result is -42. + * + * Example 3: + * + * Input: s = "4193 with words" + * Output: 4193 + * Explanation: + * Step 1: "4193 with words" (no characters read because there is no leading whitespace) + * ^ + * Step 2: "4193 with words" (no characters read because there is neither a '-' nor '+') + * ^ + * Step 3: "4193 with words" ("4193" is read in; reading stops because the next character is a non-digit) + * ^ + * The parsed integer is 4193. + * Since 4193 is in the range [-2^31, 2^31 - 1], the final result is 4193. + * + * Example 4: + * + * Input: s = "words and 987" + * Output: 0 + * Explanation: + * Step 1: "words and 987" (no characters read because there is no leading whitespace) + * ^ + * Step 2: "words and 987" (no characters read because there is neither a '-' nor '+') + * ^ + * Step 3: "words and 987" (reading stops immediately because there is a non-digit 'w') + * ^ + * The parsed integer is 0 because no digits were read. + * Since 0 is in the range [-2^31, 2^31 - 1], the final result is 0. + * + * Example 5: + * + * Input: s = "-91283472332" + * Output: -2147483648 + * Explanation: + * Step 1: "-91283472332" (no characters read because there is no leading whitespace) + * ^ + * Step 2: "-91283472332" ('-' is read, so the result should be negative) + * ^ + * Step 3: "-91283472332" ("91283472332" is read in) + * ^ + * The parsed integer is -91283472332. + * Since -91283472332 is less than the lower bound of the range [-2^31, 2^31 - 1], the final result is clamped to -2^31 = -2147483648. + * + * + * Constraints: + * + * 0 <= s.length <= 200 + * s consists of English letters (lower-case and upper-case), digits (0-9), ' ', '+', '-', and '.'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/string-to-integer-atoi/ +// discuss: https://leetcode.com/problems/string-to-integer-atoi/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn my_atoi(s: String) -> i32 { + let s : Vec = s.chars().collect(); + // trim empty prefix + let mut prefix_space_count : usize = 0; + for (i, &c) in s.iter().enumerate() { + if c != ' ' { + prefix_space_count = i; + break; + } + } + let s : Vec = s[prefix_space_count..].iter().cloned().collect(); + if s.len() == 0 {return 0} + + let mut i : usize = 0; + let mut signed : i32 = 1; + if s[0] == '+' { + signed = 1; + i+=1; + } else if s[0] == '-' { + signed = -1; + i+=1; + } else if !s[0].is_ascii_digit() { + return 0; + } + + let mut result : i32 = 0; + while i < s.len() && s[i].is_ascii_digit() { + // println!("i={},result={},s[i]={}",i, result,s[i]); + if let Some(r) = result.checked_mul(10i32) { + result = r; + } else if signed == 1 { + return 2_147_483_647i32; + } else { + return -2_147_483_648i32; + } + + if let Some(r) = result.checked_add((s[i] as u8 - '0' as u8) as i32) { + result = r; + } else if signed == 1 { + return 2_147_483_647i32; + } else { + return -2_147_483_648i32; + } + + if let Some(r) = result.checked_mul(signed) { + // result = r; + } else if signed == 1 { + return 2_147_483_647i32; + } else { + return -2_147_483_648i32; + } + i+=1; + } + result * signed + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_8() { + assert_eq!(Solution::my_atoi("aa".to_string()), 0); + assert_eq!(Solution::my_atoi("-91283472332".to_string()), -2147483648); + assert_eq!(Solution::my_atoi("words and 987".to_string()), 0); + assert_eq!(Solution::my_atoi("4193 with words".to_string()), 4193); + assert_eq!(Solution::my_atoi("42".to_string()), 42); + assert_eq!(Solution::my_atoi(" -42".to_string()), -42); + assert_eq!(Solution::my_atoi("004193333".to_string()), 4193333); + } +} diff --git a/src/problem/p0010_regular_expression_matching.rs b/src/problem/p0010_regular_expression_matching.rs new file mode 100644 index 00000000..aa94eaed --- /dev/null +++ b/src/problem/p0010_regular_expression_matching.rs @@ -0,0 +1,135 @@ +/** + * [10] Regular Expression Matching + * + * Given an input string (s) and a pattern (p), implement regular expression matching with support for '.' and '*' where: + * + * '.' Matches any single character.​​​​ + * '*' Matches zero or more of the preceding element. + * + * The matching should cover the entire input string (not partial). + * + * Example 1: + * + * Input: s = "aa", p = "a" + * Output: false + * Explanation: "a" does not match the entire string "aa". + * + * Example 2: + * + * Input: s = "aa", p = "a*" + * Output: true + * Explanation: '*' means zero or more of the preceding element, 'a'. Therefore, by repeating 'a' once, it becomes "aa". + * + * Example 3: + * + * Input: s = "ab", p = ".*" + * Output: true + * Explanation: ".*" means "zero or more (*) of any character (.)". + * + * Example 4: + * + * Input: s = "aab", p = "c*a*b" + * Output: true + * Explanation: c can be repeated 0 times, a can be repeated 1 time. Therefore, it matches "aab". + * + * Example 5: + * + * Input: s = "mississippi", p = "mis*is*p*." + * Output: false + * + * + * Constraints: + * + * 0 <= s.length <= 20 + * 0 <= p.length <= 30 + * s contains only lowercase English letters. + * p contains only lowercase English letters, '.', and '*'. + * It is guaranteed for each appearance of the character '*', there will be a previous valid character to match. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/regular-expression-matching/ +// discuss: https://leetcode.com/problems/regular-expression-matching/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn is_match(s: String, p: String) -> bool { + let mut pattern : Vec<(char, bool)> = vec![]; // bool indicate wether it is repeatable. + let mut i : usize = 0; + let s : Vec = s.chars().collect(); // into a vector for random access + let p : Vec = p.chars().collect(); // into a vector for random access + while i < p.len() { + let this_char : char = p[i]; + let mut repeatable : bool = false; + if i < p.len() - 1 && p[i+1] == '*' { + repeatable = true; + i+=1; + } + pattern.push((this_char, repeatable)); + i+=1; + } + // println!("pattern: {:?}", pattern); + + // "" can match any repeatable patterns + let s_len : usize = s.len(); + let pattern_len : usize = pattern.len(); + let mut matches : Vec> = vec![vec![false; pattern_len + 1];s_len + 1]; + matches[0][0] = true; + for (i, sub_pattern) in pattern.iter().enumerate() { + if sub_pattern.1 { + matches[0][i+1] = true; + } else { + break; + } + } + + for i in 1..=s_len { + let cur_str_char : char = s[i-1]; + for j in 1..=pattern_len { + let cur_pattern_char : char = pattern[j-1].0; + let cur_repeatable : bool = pattern[j-1].1; + if cur_repeatable { + if cur_str_char == cur_pattern_char || cur_pattern_char == '.' { + // match * to no char or cur char. + matches[i][j] = matches[i][j-1] || matches[i-1][j]; + } else { + // match * to no char + matches[i][j] = matches[i][j-1]; + } + + } else { + if cur_str_char == cur_pattern_char || cur_pattern_char == '.' { + matches[i][j] = matches[i-1][j-1]; + } else { + matches[i][j] = false; + } + } + + } + } + + // for i in 0..=s_len { + // println!("{:?}", matches[i]); + // } + + matches[s_len][pattern_len] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_10() { + assert!(Solution::is_match("aab".to_owned(), "c*a*b".to_owned())); + assert!(Solution::is_match("ab".to_owned(), ".*".to_owned())); + assert!(!Solution::is_match("aa".to_owned(), "a".to_owned())); + assert!(Solution::is_match("aa".to_owned(), "a*".to_owned())); + assert!(!Solution::is_match("mississippi".to_owned(), "mis*is*p*.".to_owned())); + } +} diff --git a/src/problem/p0011_container_with_most_water.rs b/src/problem/p0011_container_with_most_water.rs new file mode 100644 index 00000000..1148b9b7 --- /dev/null +++ b/src/problem/p0011_container_with_most_water.rs @@ -0,0 +1,74 @@ +/** + * [11] Container With Most Water + * + * Given n non-negative integers a1, a2, ..., an , where each represents a point at coordinate (i, ai). n vertical lines are drawn such that the two endpoints of the line i is at (i, ai) and (i, 0). Find two lines, which, together with the x-axis forms a container, such that the container contains the most water. + * Notice that you may not slant the container. + * + * Example 1: + * + * Input: height = [1,8,6,2,5,4,8,3,7] + * Output: 49 + * Explanation: The above vertical lines are represented by array [1,8,6,2,5,4,8,3,7]. In this case, the max area of water (blue section) the container can contain is 49. + * + * Example 2: + * + * Input: height = [1,1] + * Output: 1 + * + * Example 3: + * + * Input: height = [4,3,2,1,4] + * Output: 16 + * + * Example 4: + * + * Input: height = [1,2,1] + * Output: 2 + * + * + * Constraints: + * + * n == height.length + * 2 <= n <= 10^5 + * 0 <= height[i] <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/container-with-most-water/ +// discuss: https://leetcode.com/problems/container-with-most-water/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn max_area(height: Vec) -> i32 { + let (mut i, mut j) = (0usize, height.len() - 1); + let mut max_area= 0; + while i < j { + let area =(j-i) * std::cmp::min(height[i], height[j]) as usize; + if max_area < area { + max_area = area; + } + if height[i] < height[j] { + i+=1; + } else { + j-=1; + } + } + max_area as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_11() { + assert_eq!(Solution::max_area(vec![1, 8, 6, 2, 5, 4, 8, 3, 7]), 49); + assert_eq!(Solution::max_area(vec![6, 9]), 6); + assert_eq!(Solution::max_area(vec![1, 1, 2, 1, 1, 1]), 5); + } +} diff --git a/src/problem/p0012_integer_to_roman.rs b/src/problem/p0012_integer_to_roman.rs new file mode 100644 index 00000000..3e2769a7 --- /dev/null +++ b/src/problem/p0012_integer_to_roman.rs @@ -0,0 +1,141 @@ +/** + * [12] Integer to Roman + * + * Roman numerals are represented by seven different symbols: I, V, X, L, C, D and M. + * + * Symbol Value + * I 1 + * V 5 + * X 10 + * L 50 + * C 100 + * D 500 + * M 1000 + * For example, 2 is written as II in Roman numeral, just two one's added together. 12 is written as XII, which is simply X + II. The number 27 is written as XXVII, which is XX + V + II. + * Roman numerals are usually written largest to smallest from left to right. However, the numeral for four is not IIII. Instead, the number four is written as IV. Because the one is before the five we subtract it making four. The same principle applies to the number nine, which is written as IX. There are six instances where subtraction is used: + * + * I can be placed before V (5) and X (10) to make 4 and 9. + * X can be placed before L (50) and C (100) to make 40 and 90. + * C can be placed before D (500) and M (1000) to make 400 and 900. + * + * Given an integer, convert it to a roman numeral. + * + * Example 1: + * + * Input: num = 3 + * Output: "III" + * + * Example 2: + * + * Input: num = 4 + * Output: "IV" + * + * Example 3: + * + * Input: num = 9 + * Output: "IX" + * + * Example 4: + * + * Input: num = 58 + * Output: "LVIII" + * Explanation: L = 50, V = 5, III = 3. + * + * Example 5: + * + * Input: num = 1994 + * Output: "MCMXCIV" + * Explanation: M = 1000, CM = 900, XC = 90 and IV = 4. + * + * + * Constraints: + * + * 1 <= num <= 3999 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/integer-to-roman/ +// discuss: https://leetcode.com/problems/integer-to-roman/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn int_to_roman(mut num: i32) -> String { + let mut result : Vec = vec![]; + let m_count : i32 = num / 1000i32; + for i in 0..m_count { + result.push('M'); + } + num = num % 1000i32; + if num >= 900 { + result.push('C'); + result.push('M'); + num -= 900; + } else if num >= 500 { + result.push('D'); + num -= 500; + } else if num >= 400 { + result.push('C'); + result.push('D'); + num -= 400; + } + + let c_count : i32 = num / 100i32; + num = num % 100i32; + for i in 0..c_count { + result.push('C'); + } + if num >= 90 { + result.push('X'); + result.push('C'); + num -= 90; + } else if num >= 50 { + result.push('L'); + num -= 50; + } else if num >= 40 { + result.push('X'); + result.push('L'); + num -= 40; + } + + let x_count : i32 = num / 10i32; + num = num % 10; + for i in 0..x_count { + result.push('X'); + } + + if num >= 9 { + result.push('I'); + result.push('X'); + num -= 9; + } else if num >= 5 { + result.push('V'); + num -= 5; + } else if num >= 4 { + result.push('I'); + result.push('V'); + num -= 40; + } + + for i in 0..num { + result.push('I'); + } + result.into_iter().collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_12() { + assert_eq!(Solution::int_to_roman(3), "III"); + assert_eq!(Solution::int_to_roman(4), "IV"); + assert_eq!(Solution::int_to_roman(9), "IX"); + assert_eq!(Solution::int_to_roman(1994), "MCMXCIV"); + } +} diff --git a/src/problem/p0015_3sum.rs b/src/problem/p0015_3sum.rs new file mode 100644 index 00000000..20871f89 --- /dev/null +++ b/src/problem/p0015_3sum.rs @@ -0,0 +1,70 @@ + +/** + * [15] 3Sum + * + * Given an array nums of n integers, are there elements a, b, c in nums such that a + b + c = 0? Find all unique triplets in the array which gives the sum of zero. + * Notice that the solution set must not contain duplicate triplets. + * + * Example 1: + * Input: nums = [-1,0,1,2,-1,-4] + * Output: [[-1,-1,2],[-1,0,1]] + * Example 2: + * Input: nums = [] + * Output: [] + * Example 3: + * Input: nums = [0] + * Output: [] + * + * Constraints: + * + * 0 <= nums.length <= 3000 + * -10^5 <= nums[i] <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/3sum/ +// discuss: https://leetcode.com/problems/3sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; + +impl Solution { + pub fn three_sum(mut nums: Vec) -> Vec> { + nums.sort(); + let mut num2idx = HashMap::new(); + + for (idx, num) in nums.iter().enumerate() { + let diff = 0 - num; + num2idx.insert(num, idx); + } + + + let mut result = vec![]; + for (i, &num1) in nums.iter().enumerate() { + if 0 < i && nums[i-1] == num1 {continue; } + + for j in (i+1..nums.len()) { + if i+1 < j && nums[j-1] == nums[j] {continue; } + let diff = 0 - num1 - nums[j]; + if let Some(&idx) = num2idx.get(&diff) { + if j < idx { + result.push(vec![nums[i], nums[j], nums[idx]]); + } + } + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_15() { + } +} diff --git a/src/problem/p0016_3sum_closest.rs b/src/problem/p0016_3sum_closest.rs new file mode 100644 index 00000000..14faa1e7 --- /dev/null +++ b/src/problem/p0016_3sum_closest.rs @@ -0,0 +1,72 @@ +/** + * [16] 3Sum Closest + * + * Given an array nums of n integers and an integer target, find three integers in nums such that the sum is closest to target. Return the sum of the three integers. You may assume that each input would have exactly one solution. + * + * Example 1: + * + * Input: nums = [-1,2,1,-4], target = 1 + * Output: 2 + * Explanation: The sum that is closest to the target is 2. (-1 + 2 + 1 = 2). + * + * + * Constraints: + * + * 3 <= nums.length <= 10^3 + * -10^3 <= nums[i] <= 10^3 + * -10^4 <= target <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/3sum-closest/ +// discuss: https://leetcode.com/problems/3sum-closest/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn three_sum_closest(mut nums: Vec, target: i32) -> i32 { + nums.sort(); + let mut min_diff = 100000000; + let mut nearest_sum = target; + for (i, &num) in nums.iter().enumerate() { + let mut low = i + 1; + let mut high = nums.len() - 1; + // println!("i = {}", i); + while low < high { + let cur_sum = nums[i] + nums[low] + nums[high]; + // println!("\tlow = {}, high = {}, sum = {}", low, high, cur_sum); + + let mut diff : i32; + if target < cur_sum { + diff = cur_sum - target; + high -= 1; + } else { + diff = target - cur_sum; + low += 1; + } + + if diff < min_diff { + min_diff = diff; + nearest_sum = cur_sum; + } + } + + // println!("=============================="); + } + nearest_sum + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_16() { + assert_eq!(Solution::three_sum_closest(vec![-1,2,1,-4], 1), 2); + + } +} diff --git a/src/problem/p0017_letter_combinations_of_a_phone_number.rs b/src/problem/p0017_letter_combinations_of_a_phone_number.rs new file mode 100644 index 00000000..099eaa2b --- /dev/null +++ b/src/problem/p0017_letter_combinations_of_a_phone_number.rs @@ -0,0 +1,90 @@ +/** + * [17] Letter Combinations of a Phone Number + * + * Given a string containing digits from 2-9 inclusive, return all possible letter combinations that the number could represent. Return the answer in any order. + * A mapping of digit to letters (just like on the telephone buttons) is given below. Note that 1 does not map to any letters. + * + * + * Example 1: + * + * Input: digits = "23" + * Output: ["ad","ae","af","bd","be","bf","cd","ce","cf"] + * + * Example 2: + * + * Input: digits = "" + * Output: [] + * + * Example 3: + * + * Input: digits = "2" + * Output: ["a","b","c"] + * + * + * Constraints: + * + * 0 <= digits.length <= 4 + * digits[i] is a digit in the range ['2', '9']. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/letter-combinations-of-a-phone-number/ +// discuss: https://leetcode.com/problems/letter-combinations-of-a-phone-number/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn helper(results : &mut Vec, tmp : &mut Vec, digits : &Vec, letters : &Vec>) { + if tmp.len() == digits.len() { + results.push(tmp.iter().clone().collect()); + return; + } + + let cur_pos : usize = tmp.len(); + let digit : usize = (digits[cur_pos] as u8 - '0' as u8) as usize; + for &letter in letters[digit].iter() { + tmp.push(letter); + Self::helper(results, tmp, digits, letters); + tmp.pop(); + } + + } + + pub fn letter_combinations(digits: String) -> Vec { + let digits : Vec = digits.chars().collect(); + if digits.len() == 0 {return vec![];} + let mut results : Vec = vec![]; + let mut tmp : Vec = vec![]; + let letters : Vec> = vec![ + vec![], // 0 + vec![], // 1 + vec!['a', 'b', 'c'], // 2 + vec!['d', 'e', 'f'], // 3 + vec!['g', 'h', 'i'], // 4 + vec!['j', 'k', 'l'], // 5 + vec!['m', 'n', 'o'], // 6 + vec!['p', 'q', 'r', 's'], // 7 + vec!['t', 'u', 'v'], // 8 + vec!['w', 'x', 'y', 'z'], // 9 + ]; + + Self::helper(&mut results, &mut tmp, &digits, &letters); + results + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_17() { + assert_eq!( + Solution::letter_combinations("23".to_string()), + ["cf", "af", "bf", "cd", "ce", "ad", "ae", "bd", "be"] + ); + } +} diff --git a/src/problem/p0018_4sum.rs b/src/problem/p0018_4sum.rs new file mode 100644 index 00000000..caac5d41 --- /dev/null +++ b/src/problem/p0018_4sum.rs @@ -0,0 +1,102 @@ +/** + * [18] 4Sum + * + * Given an array nums of n integers, return an array of all the unique quadruplets [nums[a], nums[b], nums[c], nums[d]] such that: + * + * 0 <= a, b, c, d < n + * a, b, c, and d are distinct. + * nums[a] + nums[b] + nums[c] + nums[d] == target + * + * You may return the answer in any order. + * + * Example 1: + * + * Input: nums = [1,0,-1,0,-2,2], target = 0 + * Output: [[-2,-1,1,2],[-2,0,0,2],[-1,0,0,1]] + * + * Example 2: + * + * Input: nums = [2,2,2,2,2], target = 8 + * Output: [[2,2,2,2]] + * + * + * Constraints: + * + * 1 <= nums.length <= 200 + * -10^9 <= nums[i] <= 10^9 + * -10^9 <= target <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/4sum/ +// discuss: https://leetcode.com/problems/4sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn four_sum(mut nums: Vec, target: i32) -> Vec> { + if nums.len() <= 3 {return vec![];} + nums.sort(); + let mut result : Vec> = vec![]; + let mut num2pos : HashMap = HashMap::new(); + + for i in 0..nums.len() { + num2pos.insert(nums[i], i); // the last pos wins. + } + + let mut i : usize = 0; + let mut result : Vec> = vec![]; + while i < nums.len() { + while i != 0 && i < nums.len() && nums[i-1] == nums[i] { + i+=1; + } + if i == nums.len() {break} + + let num1 : i32 = nums[i]; + let mut j : usize = i + 1; + while j < nums.len() { + while j != i+1 && j < nums.len() && nums[j-1] == nums[j] { + j+=1; + } + if j == nums.len() {break} + let num2 : i32 = nums[j]; + let mut k : usize = j + 1; + + while k < nums.len() { + while k != j+1 && k < nums.len() && nums[k-1] == nums[k] { + k+=1; + } + if k == nums.len() {break} + let num3 : i32 = nums[k]; + + let num4 : i32 = target - num1 - num2 - num3; + if let Some(&num4_pos) = num2pos.get(&num4) { + if num4_pos > k { + result.push(vec![num1, num2, num3, num4]); + } + } + k +=1; + } + j+=1; + } + i+=1; + } + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_18() { + assert_eq!(Solution::four_sum(vec![1,0,-1,0,-2,2], 0), vec![vec![-2,-1,1,2],vec![-2,0,0,2],vec![-1,0,0,1]]); + + assert_eq!(Solution::four_sum(vec![2,2,2,2,2], 8), vec![vec![2,2,2,2]]); + } +} diff --git a/src/problem/p0019_remove_nth_node_from_end_of_list.rs b/src/problem/p0019_remove_nth_node_from_end_of_list.rs new file mode 100644 index 00000000..bc257fa0 --- /dev/null +++ b/src/problem/p0019_remove_nth_node_from_end_of_list.rs @@ -0,0 +1,102 @@ +/** + * [19] Remove Nth Node From End of List + * + * Given the head of a linked list, remove the n^th node from the end of the list and return its head. + * Follow up: Could you do this in one pass? + * + * Example 1: + * + * Input: head = [1,2,3,4,5], n = 2 + * Output: [1,2,3,5] + * + * Example 2: + * + * Input: head = [1], n = 1 + * Output: [] + * + * Example 3: + * + * Input: head = [1,2], n = 1 + * Output: [1] + * + * + * Constraints: + * + * The number of nodes in the list is sz. + * 1 <= sz <= 30 + * 0 <= Node.val <= 100 + * 1 <= n <= sz + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/remove-nth-node-from-end-of-list/ +// discuss: https://leetcode.com/problems/remove-nth-node-from-end-of-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn remove_nth_from_end(head: Option>, n: i32) -> Option> { + let mut node : &Option> = &head; + let mut node_count = 0usize; + while node.is_some() { + node_count += 1; + node = &(node.as_ref().unwrap().next); + } + + let n = n as usize; + let mut head = head; + if node_count == n { + // we are removing the head. + return head.unwrap().next; + } else { + let mut idx : usize = node_count - n - 1; + // Find the preceding of the removed node. + let mut node : &mut Option> = &mut head; + + while 0 < idx { + node = &mut (node.as_mut().unwrap().next); + idx -= 1; + } + // Since we are manipulating via mut ref, must take() to move the content out. + let next_node = node.as_mut().unwrap().next.as_mut().unwrap().next.take(); + node.as_mut().unwrap().next = next_node; + + return head; + } + + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_19() { + assert_eq!( + Solution::remove_nth_from_end(to_list(vec![1, 2, 3, 4, 5]), 2), + to_list(vec![1, 2, 3, 5]) + ); + assert_eq!(Solution::remove_nth_from_end(to_list(vec![1]), 1), None); + } +} diff --git a/src/problem/p0020_valid_parentheses.rs b/src/problem/p0020_valid_parentheses.rs new file mode 100644 index 00000000..0918d609 --- /dev/null +++ b/src/problem/p0020_valid_parentheses.rs @@ -0,0 +1,94 @@ +/** + * [20] Valid Parentheses + * + * Given a string s containing just the characters '(', ')', '{', '}', '[' and ']', determine if the input string is valid. + * An input string is valid if: + *
    + * Open brackets must be closed by the same type of brackets. + * Open brackets must be closed in the correct order. + *
+ * + * Example 1: + * + * Input: s = "()" + * Output: true + * + * Example 2: + * + * Input: s = "()[]{}" + * Output: true + * + * Example 3: + * + * Input: s = "(]" + * Output: false + * + * Example 4: + * + * Input: s = "([)]" + * Output: false + * + * Example 5: + * + * Input: s = "{[]}" + * Output: true + * + * + * Constraints: + * + * 1 <= s.length <= 10^4 + * s consists of parentheses only '()[]{}'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/valid-parentheses/ +// discuss: https://leetcode.com/problems/valid-parentheses/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn is_valid(s: String) -> bool { + let mut stack = vec![]; + for c in s.chars() { + match(c) { + '(' | '[' | '{' => {stack.push(c)}, + ')' => { + if let Some('(') = stack.pop() { + // do nothing + } else { + return false; + } + }, + ']' => { + if let Some('[') = stack.pop() { + // do nothing + } else { + return false; + } + }, + '}' => { + if let Some('{') = stack.pop() { + // do nothing + } else { + return false; + } + }, + _ => {panic!("Unrecognized char...")} + }; + } + return stack.len() == 0; + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_20() { + assert_eq!(Solution::is_valid("()[]{}".to_string()), true); + } +} diff --git a/src/problem/p0021_merge_two_sorted_lists.rs b/src/problem/p0021_merge_two_sorted_lists.rs new file mode 100644 index 00000000..7a3c8bbe --- /dev/null +++ b/src/problem/p0021_merge_two_sorted_lists.rs @@ -0,0 +1,85 @@ +/** + * [21] Merge Two Sorted Lists + * + * Merge two sorted linked lists and return it as a sorted list. The list should be made by splicing together the nodes of the first two lists. + * + * Example 1: + * + * Input: l1 = [1,2,4], l2 = [1,3,4] + * Output: [1,1,2,3,4,4] + * + * Example 2: + * + * Input: l1 = [], l2 = [] + * Output: [] + * + * Example 3: + * + * Input: l1 = [], l2 = [0] + * Output: [0] + * + * + * Constraints: + * + * The number of nodes in both lists is in the range [0, 50]. + * -100 <= Node.val <= 100 + * Both l1 and l2 are sorted in non-decreasing order. + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/merge-two-sorted-lists/ +// discuss: https://leetcode.com/problems/merge-two-sorted-lists/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn merge_two_lists(l1: Option>, l2: Option>) -> Option> { + match (l1, l2) { + (Some(mut l1_node), Some(mut l2_node)) =>{ + if (l1_node.val <= l2_node.val) { + l1_node.next = Self::merge_two_lists(l1_node.next, Some(l2_node)); + Some(l1_node) + } else { + l2_node.next = Self::merge_two_lists(Some(l1_node), l2_node.next); + Some(l2_node) + } + }, + (Some(l1_node), None) => Some(l1_node), + (None, Some(l2_node)) => Some(l2_node), + (None, None) => None + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_21() { + assert_eq!( + Solution::merge_two_lists(to_list(vec![1, 2, 4]), to_list(vec![1, 3, 4])), + to_list(vec![1, 1, 2, 3, 4, 4]) + ); + } +} diff --git a/src/problem/p0022_generate_parentheses.rs b/src/problem/p0022_generate_parentheses.rs new file mode 100644 index 00000000..6d194437 --- /dev/null +++ b/src/problem/p0022_generate_parentheses.rs @@ -0,0 +1,67 @@ +/** + * [22] Generate Parentheses + * + * Given n pairs of parentheses, write a function to generate all combinations of well-formed parentheses. + * + * Example 1: + * Input: n = 3 + * Output: ["((()))","(()())","(())()","()(())","()()()"] + * Example 2: + * Input: n = 1 + * Output: ["()"] + * + * Constraints: + * + * 1 <= n <= 8 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/generate-parentheses/ +// discuss: https://leetcode.com/problems/generate-parentheses/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +impl Solution { + pub fn helper(result : &mut Vec, tmp : &mut Vec, unclosed_count : i32, total_count : i32) { + let len : i32 = tmp.len() as i32; + if len == 2 * total_count { + result.push(tmp.iter().cloned().collect()); + return; + } + if unclosed_count < 2 * total_count - len { + tmp.push('('); + Self::helper(result, tmp, unclosed_count + 1, total_count); + tmp.pop(); + } + + if unclosed_count > 0 { + tmp.push(')'); + Self::helper(result, tmp, unclosed_count - 1, total_count); + tmp.pop(); + } + } + + pub fn generate_parenthesis(n: i32) -> Vec { + let mut result : Vec = vec![]; + let mut tmp : Vec = vec![]; + Self::helper(&mut result, &mut tmp, 0, n); + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_22() { + assert_eq!(Solution::generate_parenthesis(1), vec!["()"]); + assert_eq!(Solution::generate_parenthesis(2), vec!["(())", "()()"]); + assert_eq!( + Solution::generate_parenthesis(3), + vec!["((()))", "(()())", "(())()", "()(())", "()()()"] + ); + } +} diff --git a/src/problem/p0023_merge_k_sorted_lists.rs b/src/problem/p0023_merge_k_sorted_lists.rs new file mode 100644 index 00000000..23e2fad1 --- /dev/null +++ b/src/problem/p0023_merge_k_sorted_lists.rs @@ -0,0 +1,129 @@ +/** + * [23] Merge k Sorted Lists + * + * You are given an array of k linked-lists lists, each linked-list is sorted in ascending order. + * Merge all the linked-lists into one sorted linked-list and return it. + * + * Example 1: + * + * Input: lists = [[1,4,5],[1,3,4],[2,6]] + * Output: [1,1,2,3,4,4,5,6] + * Explanation: The linked-lists are: + * [ + * 1->4->5, + * 1->3->4, + * 2->6 + * ] + * merging them into one sorted list: + * 1->1->2->3->4->4->5->6 + * + * Example 2: + * + * Input: lists = [] + * Output: [] + * + * Example 3: + * + * Input: lists = [[]] + * Output: [] + * + * + * Constraints: + * + * k == lists.length + * 0 <= k <= 10^4 + * 0 <= lists[i].length <= 500 + * -10^4 <= lists[i][j] <= 10^4 + * lists[i] is sorted in ascending order. + * The sum of lists[i].length won't exceed 10^4. + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/merge-k-sorted-lists/ +// discuss: https://leetcode.com/problems/merge-k-sorted-lists/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + + pub fn merge_two(mut l1: Option>, mut l2: Option>)-> Option> { + match(l1,l2) { + (None, None)=>{None}, + (None, Some(l2_node))=>{Some(l2_node)}, + (Some(l1_node), None)=>{Some(l1_node)}, + (Some(mut l1_node), Some(mut l2_node))=>{ + if l1_node.val < l2_node.val { + l1_node.next = Self::merge_two(l1_node.next, Some(l2_node)); + Some(l1_node) + } else { + l2_node.next = Self::merge_two(Some(l1_node), l2_node.next); + Some(l2_node) + } + } + } + } + + pub fn merge_k_lists(mut lists: Vec>>) -> Option> { + + if lists.len() == 0 { + None + } else if lists.len() == 1 { + lists[0].take() + } else if lists.len() == 2 { + Self::merge_two(lists[0].take(), lists[1].take()) + } else { + let mid = lists.len() / 2; + let mut first_half = vec![]; + let mut sec_half = vec![]; + for i in 0..lists.len() { + if i < mid { + first_half.push(lists[i].take()); + } else { + sec_half.push(lists[i].take()); + } + } + + let mut first_merged = Self::merge_k_lists(first_half); + let mut sec_merged = Self::merge_k_lists(sec_half); + Self::merge_two(first_merged, sec_merged) + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_23() { + assert_eq!( + Solution::merge_k_lists(vec![ + to_list(vec![1, 4, 5]), + to_list(vec![1, 3, 4]), + to_list(vec![2, 6]), + ]), + to_list(vec![1, 1, 2, 3, 4, 4, 5, 6]) + ); + assert_eq!(Solution::merge_k_lists(vec![]), None); + } +} diff --git a/src/problem/p0024_swap_nodes_in_pairs.rs b/src/problem/p0024_swap_nodes_in_pairs.rs new file mode 100644 index 00000000..2ac4b211 --- /dev/null +++ b/src/problem/p0024_swap_nodes_in_pairs.rs @@ -0,0 +1,88 @@ +/** + * [24] Swap Nodes in Pairs + * + * Given a linked list, swap every two adjacent nodes and return its head. + * + * Example 1: + * + * Input: head = [1,2,3,4] + * Output: [2,1,4,3] + * + * Example 2: + * + * Input: head = [] + * Output: [] + * + * Example 3: + * + * Input: head = [1] + * Output: [1] + * + * + * Constraints: + * + * The number of nodes in the list is in the range [0, 100]. + * 0 <= Node.val <= 100 + * + * + * Follow up: Can you solve the problem without modifying the values in the list's nodes? (i.e., Only nodes themselves may be changed.) + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/swap-nodes-in-pairs/ +// discuss: https://leetcode.com/problems/swap-nodes-in-pairs/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn swap_pairs(head: Option>) -> Option> { + if head.is_none() || head.as_ref().unwrap().next.is_none() { + head + } else { + let mut node1 : Option> = head; + let mut node2 : Option> = node1.as_mut().unwrap().next.take(); + let node3 : Option> = node2.as_mut().unwrap().next.take(); + node1.as_mut().unwrap().next = Self::swap_pairs(node3); + node2.as_mut().unwrap().next = node1; + node2 + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_24() { + assert_eq!( + Solution::swap_pairs(to_list(vec![1, 2, 3, 4])), + to_list(vec![2, 1, 4, 3]) + ); + assert_eq!(Solution::swap_pairs(to_list(vec![])), to_list(vec![])); + assert_eq!( + Solution::swap_pairs(to_list(vec![1, 2, 3])), + to_list(vec![2, 1, 3]) + ); + assert_eq!(Solution::swap_pairs(to_list(vec![1])), to_list(vec![1])); + } +} diff --git a/src/problem/p0025_reverse_nodes_in_k_group.rs b/src/problem/p0025_reverse_nodes_in_k_group.rs new file mode 100644 index 00000000..cdf37233 --- /dev/null +++ b/src/problem/p0025_reverse_nodes_in_k_group.rs @@ -0,0 +1,142 @@ +/** + * [25] Reverse Nodes in k-Group + * + * Given a linked list, reverse the nodes of a linked list k at a time and return its modified list. + * k is a positive integer and is less than or equal to the length of the linked list. If the number of nodes is not a multiple of k then left-out nodes, in the end, should remain as it is. + * Follow up: + * + * Could you solve the problem in O(1) extra memory space? + * You may not alter the values in the list's nodes, only nodes itself may be changed. + * + * + * Example 1: + * + * Input: head = [1,2,3,4,5], k = 2 + * Output: [2,1,4,3,5] + * + * Example 2: + * + * Input: head = [1,2,3,4,5], k = 3 + * Output: [3,2,1,4,5] + * + * Example 3: + * + * Input: head = [1,2,3,4,5], k = 1 + * Output: [1,2,3,4,5] + * + * Example 4: + * + * Input: head = [1], k = 1 + * Output: [1] + * + * + * Constraints: + * + * The number of nodes in the list is in the range sz. + * 1 <= sz <= 5000 + * 0 <= Node.val <= 1000 + * 1 <= k <= sz + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/reverse-nodes-in-k-group/ +// discuss: https://leetcode.com/problems/reverse-nodes-in-k-group/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn reverse_list(head: Option>) -> Option> { + + let mut reversed = None; + let mut unreversed = head; + while let Some(mut unreversed_node) = unreversed { + unreversed = unreversed_node.next; + unreversed_node.next = reversed; + reversed = Some(unreversed_node); + } + + reversed + } + + pub fn reverse_k_group(mut head: Option>, k: i32) -> Option> { + if head.is_none() {return None} + + let mut fake_head = Some(Box::new(ListNode::new(0))); + let mut processed_tail : &mut Box = fake_head.as_mut().unwrap(); + + let mut cur_head : Option> = head; + + // println!("cur_head={}", cur_node.val); + let mut cur_node : &mut Box = cur_head.as_mut().unwrap(); + + let mut count = (k - 1) as usize; + while cur_node.next.is_some() && count > 0 { + // println!("\tcur_node={}", cur_node.val); + cur_node = cur_node.next.as_mut().unwrap(); + count -= 1; + } + // println!("tail_node={}", cur_node.val); + // println!("cur_head={}", cur_head.as_ref().unwrap().val); + if count == 0 { + // there are more than k elements later. + let next_head = cur_node.next.take(); + processed_tail.next = Self::reverse_list(cur_head); + + while processed_tail.next.is_some() { + // println!("\tprocessed_tail={}", processed_tail.val); + processed_tail = processed_tail.next.as_mut().unwrap(); + } + processed_tail.next = Self::reverse_k_group(next_head, k); + fake_head.unwrap().next + + } else { + cur_head + } + + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_25() { + assert_eq!( + Solution::reverse_k_group(to_list(vec![1, 2, 3, 4, 5]), 2), + to_list(vec![2, 1, 4, 3, 5]) + ); + assert_eq!( + Solution::reverse_k_group(to_list(vec![1, 2, 3, 4, 5]), 3), + to_list(vec![3, 2, 1, 4, 5]) + ); + assert_eq!( + Solution::reverse_k_group(to_list(vec![1, 2, 3, 4, 5]), 5), + to_list(vec![5, 4, 3, 2, 1]) + ); + assert_eq!( + Solution::reverse_k_group(to_list(vec![1]), 1), + to_list(vec![1]) + ); + } +} diff --git a/src/problem/p0029_divide_two_integers.rs b/src/problem/p0029_divide_two_integers.rs new file mode 100644 index 00000000..61664137 --- /dev/null +++ b/src/problem/p0029_divide_two_integers.rs @@ -0,0 +1,107 @@ +/** + * [29] Divide Two Integers + * + * Given two integers dividend and divisor, divide two integers without using multiplication, division, and mod operator. + * Return the quotient after dividing dividend by divisor. + * The integer division should truncate toward zero, which means losing its fractional part. For example, truncate(8.345) = 8 and truncate(-2.7335) = -2. + * Note: Assume we are dealing with an environment that could only store integers within the 32-bit signed integer range: [-2^31, 2^31 - 1]. For this problem, assume that your function returns 2^31 - 1 when the division result overflows. + * + * Example 1: + * + * Input: dividend = 10, divisor = 3 + * Output: 3 + * Explanation: 10/3 = truncate(3.33333..) = 3. + * + * Example 2: + * + * Input: dividend = 7, divisor = -3 + * Output: -2 + * Explanation: 7/-3 = truncate(-2.33333..) = -2. + * + * Example 3: + * + * Input: dividend = 0, divisor = 1 + * Output: 0 + * + * Example 4: + * + * Input: dividend = 1, divisor = 1 + * Output: 1 + * + * + * Constraints: + * + * -2^31 <= dividend, divisor <= 2^31 - 1 + * divisor != 0 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/divide-two-integers/ +// discuss: https://leetcode.com/problems/divide-two-integers/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn divide(mut dividend: i64, mut divisor: i64) -> i32 { + let mut sign_flipped = false; + let mut abs_result = 0i64; + if 0 < dividend && 0 < divisor { + sign_flipped = false; + } else if dividend < 0 && 0 < divisor { + dividend = -dividend; + sign_flipped = true; + } else if 0 < dividend && divisor < 0 { + sign_flipped = true; + divisor = -divisor; + } else if dividend < 0 && divisor < 0 { + sign_flipped = false; + divisor = -divisor; + dividend = -dividend; + } else if dividend == 0 { + return 0; + } + + + let mut remains = dividend; + loop { + let mut cur_shift_count = -1; + let mut cur_subtractor = divisor; + let mut last_subtractor = divisor; // the init value is meaningless + + while cur_subtractor <= remains { + cur_shift_count += 1; + last_subtractor = cur_subtractor; + cur_subtractor = cur_subtractor << 1; // *2 + } + if cur_shift_count == -1 { + break + } else { + abs_result += 1 << cur_shift_count; + remains -= last_subtractor; + } + } + + + if sign_flipped { + -(abs_result as i32) + } else { + abs_result as i32 + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_29() { + // assert_eq!(Solution::divide(10, 3), 3); + // assert_eq!(Solution::divide(7, -3), -2); + assert_eq!(Solution::divide(2147483647, 2), 1073741823); + + } +} diff --git a/src/problem/p0030_substring_with_concatenation_of_all_words.rs b/src/problem/p0030_substring_with_concatenation_of_all_words.rs new file mode 100644 index 00000000..54ad4d07 --- /dev/null +++ b/src/problem/p0030_substring_with_concatenation_of_all_words.rs @@ -0,0 +1,142 @@ +/** + * [30] Substring with Concatenation of All Words + * + * You are given a string s and an array of strings words of the same length. Return all starting indices of substring(s) in s that is a concatenation of each word in words exactly once, in any order, and without any intervening characters. + * You can return the answer in any order. + * + * Example 1: + * + * Input: s = "barfoothefoobarman", words = ["foo","bar"] + * Output: [0,9] + * Explanation: Substrings starting at index 0 and 9 are "barfoo" and "foobar" respectively. + * The output order does not matter, returning [9,0] is fine too. + * + * Example 2: + * + * Input: s = "wordgoodgoodgoodbestword", words = ["word","good","best","word"] + * Output: [] + * + * Example 3: + * + * Input: s = "barfoofoobarthefoobarman", words = ["bar","foo","the"] + * Output: [6,9,12] + * + * + * Constraints: + * + * 1 <= s.length <= 10^4 + * s consists of lower-case English letters. + * 1 <= words.length <= 5000 + * 1 <= words[i].length <= 30 + * words[i] consists of lower-case English letters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/substring-with-concatenation-of-all-words/ +// discuss: https://leetcode.com/problems/substring-with-concatenation-of-all-words/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; + +impl Solution { + pub fn find_substring(s: String, words: Vec) -> Vec { + let substr_len : usize = words[0].len(); + let str_len : usize = s.len(); + let s : Vec = s.chars().collect(); // into char vec for random access + let substr_count : usize = str_len - substr_len + 1; + let mut matches : Vec = vec![-1;substr_count]; + for i in 0..substr_count { + let sub : String = s[i..i+substr_len].iter().collect(); + for (j, word) in words.iter().enumerate() { + if word.eq(&sub) { + matches[i] = j as i32; + } + } + } + + // println!("matches = {:?}", matches); + + let mut result : Vec = vec![]; + let concat_count : usize = (str_len - substr_len * words.len() + 1) as usize; + + let mut default_needed_count : HashMap = HashMap::new(); + for word in words.iter() { + *default_needed_count.entry(word.clone()).or_insert(0) +=1; + } + + for i in 0..concat_count { + let mut j : usize = i; + let mut needed_count = default_needed_count.clone(); + while j < substr_count && matches[j] != -1 { + if let Some(count_ptr) = needed_count.get_mut(&words[matches[j] as usize]) { + if *count_ptr == 0 { + break; + } else { + *count_ptr-=1; + } + } + + j += substr_len; + } + if needed_count.values().sum::() == 0 { + result.push(i as i32); + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_30() { + assert_eq!( + Solution::find_substring( + "wordgoodgoodgoodbestword".to_string(), + vec![ + "word".to_string(), + "good".to_string(), + "best".to_string(), + "good".to_string() + ] + ), + vec![8] + ); + assert_eq!( + Solution::find_substring( + "barfoothefoobarman".to_string(), + vec!["foo".to_string(), "bar".to_string()] + ), + vec![0, 9] + ); + assert_eq!( + Solution::find_substring( + "wordgoodgoodgoodbestword".to_string(), + vec![ + "word".to_string(), + "good".to_string(), + "best".to_string(), + "word".to_string() + ] + ), + vec![] + ); + assert_eq!( + Solution::find_substring( + "xxwordgoodgoodgoodbestword".to_string(), + vec![ + "word".to_string(), + "good".to_string(), + "best".to_string(), + "good".to_string() + ] + ), + vec![10] + ); + } +} diff --git a/src/problem/p0031_next_permutation.rs b/src/problem/p0031_next_permutation.rs new file mode 100644 index 00000000..ace81662 --- /dev/null +++ b/src/problem/p0031_next_permutation.rs @@ -0,0 +1,90 @@ +/** + * [31] Next Permutation + * + * Implement next permutation, which rearranges numbers into the lexicographically next greater permutation of numbers. + * If such an arrangement is not possible, it must rearrange it as the lowest possible order (i.e., sorted in ascending order). + * The replacement must be in place and use only constant extra memory. + * + * Example 1: + * Input: nums = [1,2,3] + * Output: [1,3,2] + * Example 2: + * Input: nums = [3,2,1] + * Output: [1,2,3] + * Example 3: + * Input: nums = [1,1,5] + * Output: [1,5,1] + * Example 4: + * Input: nums = [1] + * Output: [1] + * + * Constraints: + * + * 1 <= nums.length <= 100 + * 0 <= nums[i] <= 100 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/next-permutation/ +// discuss: https://leetcode.com/problems/next-permutation/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn next_permutation(nums: &mut Vec) { + let mut k= None; // the largest index of the first increments + for i in (0..nums.len()-1).rev() { + if nums[i] < nums[i+1] { + k = Some(i); + break + } + } + if let None = k { + return nums.reverse(); + } + + let mut l = None; // the largest index that nums[l] > nums[k] + let k = k.unwrap(); + for i in (k+1..nums.len()).rev() { + if nums[k] < nums[i] { + l = Some(i); + break + } + } + let l = l.unwrap(); + nums.swap(l, k); + + // reverse nums[k+1:] + let length = nums.len(); + let sub_length = (length - (k + 1)) / 2; + // println!("k={}, l={}", k, l); + // println!("nums = {:?}", nums); + // println!("sub_length = {:?}", sub_length); + for i in 0..sub_length { + nums.swap(k+1+i, length-1-i); + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_31() { + let mut vec1 = vec![1, 3, 2]; + Solution::next_permutation(&mut vec1); + assert_eq!(vec1, vec![2, 1, 3]); + + // let mut vec1 = vec![1, 2, 3, 4, 5]; + // Solution::next_permutation(&mut vec1); + // assert_eq!(vec1, vec![1, 2, 3, 5, 4]); + + // let mut vec2 = vec![5, 4, 3, 2, 1]; + // Solution::next_permutation(&mut vec2); + // assert_eq!(vec2, vec![1, 2, 3, 4, 5]); + } +} diff --git a/src/problem/p0032_longest_valid_parentheses.rs b/src/problem/p0032_longest_valid_parentheses.rs new file mode 100644 index 00000000..68a1a8e7 --- /dev/null +++ b/src/problem/p0032_longest_valid_parentheses.rs @@ -0,0 +1,92 @@ +/** + * [32] Longest Valid Parentheses + * + * Given a string containing just the characters '(' and ')', find the length of the longest valid (well-formed) parentheses substring. + * + * Example 1: + * + * Input: s = "(()" + * Output: 2 + * Explanation: The longest valid parentheses substring is "()". + * + * Example 2: + * + * Input: s = ")()())" + * Output: 4 + * Explanation: The longest valid parentheses substring is "()()". + * + * Example 3: + * + * Input: s = "" + * Output: 0 + * + * + * Constraints: + * + * 0 <= s.length <= 3 * 10^4 + * s[i] is '(', or ')'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/longest-valid-parentheses/ +// discuss: https://leetcode.com/problems/longest-valid-parentheses/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn longest_valid_parentheses(s: String) -> i32 { + let mut longest_ending : Vec = vec![0;s.len()]; + let mut stack : Vec = vec![]; + let mut max_len : usize = 0; + for (i, c) in s.chars().enumerate() { + if c == ')' { + if let Some(left_idx) = stack.pop() { + let mut cur_len = i - left_idx + 1; + if left_idx > 0 && longest_ending[left_idx-1] > 0 { + cur_len += longest_ending[left_idx-1]; + } + longest_ending[i] = cur_len; + max_len = std::cmp::max(max_len, cur_len); + } + + } else { + stack.push(i); + } + } + max_len as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_32() { + assert_eq!(Solution::longest_valid_parentheses(")()())".to_string()), 4); + assert_eq!(Solution::longest_valid_parentheses(")(".to_string()), 0); + assert_eq!(Solution::longest_valid_parentheses("(()".to_string()), 2); + assert_eq!( + Solution::longest_valid_parentheses("(((((()()".to_string()), + 4 + ); + assert_eq!( + Solution::longest_valid_parentheses("((((((((()))".to_string()), + 6 + ); + assert_eq!(Solution::longest_valid_parentheses("()".to_string()), 2); + assert_eq!(Solution::longest_valid_parentheses("()(()".to_string()), 2); + assert_eq!( + Solution::longest_valid_parentheses(")()(((())))(".to_string()), + 10 + ); + assert_eq!( + Solution::longest_valid_parentheses("(()(((()".to_string()), + 2 + ); + assert_eq!(Solution::longest_valid_parentheses("".to_string()), 0); + } +} diff --git a/src/problem/p0033_search_in_rotated_sorted_array.rs b/src/problem/p0033_search_in_rotated_sorted_array.rs new file mode 100644 index 00000000..bc556d17 --- /dev/null +++ b/src/problem/p0033_search_in_rotated_sorted_array.rs @@ -0,0 +1,104 @@ +/** + * [33] Search in Rotated Sorted Array + * + * There is an integer array nums sorted in ascending order (with distinct values). + * Prior to being passed to your function, nums is rotated at an unknown pivot index k (0 <= k < nums.length) such that the resulting array is [nums[k], nums[k+1], ..., nums[n-1], nums[0], nums[1], ..., nums[k-1]] (0-indexed). For example, [0,1,2,4,5,6,7] might be rotated at pivot index 3 and become [4,5,6,7,0,1,2]. + * Given the array nums after the rotation and an integer target, return the index of target if it is in nums, or -1 if it is not in nums. + * + * Example 1: + * Input: nums = [4,5,6,7,0,1,2], target = 0 + * Output: 4 + * Example 2: + * Input: nums = [4,5,6,7,0,1,2], target = 3 + * Output: -1 + * Example 3: + * Input: nums = [1], target = 0 + * Output: -1 + * + * Constraints: + * + * 1 <= nums.length <= 5000 + * -10^4 <= nums[i] <= 10^4 + * All values of nums are unique. + * nums is guaranteed to be rotated at some pivot. + * -10^4 <= target <= 10^4 + * + * + * Follow up: Can you achieve this in O(log n) time complexity? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/search-in-rotated-sorted-array/ +// discuss: https://leetcode.com/problems/search-in-rotated-sorted-array/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + + pub fn search(nums: Vec, target: i32) -> i32 { + let mut low : i32 = 0; + let mut high : i32 = nums.len() as i32 - 1; + while low <= high { + let mid : i32 = (low + high) / 2; + let mid_num : i32 = nums[mid as usize]; + let right_num : i32 = nums[high as usize]; + let left_num : i32 = nums[low as usize]; + // println!("low[{}]={}, mid[{}]={}, right[{}]={}", low, left_num, mid, mid_num, high, right_num); + if mid_num == target { + return mid; + } else if left_num < mid_num { + //[low, mid] must be sorted. + if left_num <= target && target < mid_num { + // in the ordered left half + high = mid - 1; + } else { + low = mid + 1; + } + } else if left_num > mid_num { + // [mid, high] must be sorted. + if mid_num < target && target <= right_num { + // in the ordered right half + low = mid + 1; + } else { + high = mid - 1; + } + } else { + low += 1; + } + } + -1 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_33() { + // assert_eq!(Solution::search(vec![7, 8, 1, 2, 3, 4, 5, 6], 2), 3); + // assert_eq!( + // Solution::search( + // vec![ + // 1004, 1005, 1006, 1007, 1008, 1009, 1010, 1011, 1012, 0, 1, 2, 3, 4, 5, 6, 7, 8 + // ], + // 0 + // ), + // 9 + // ); + // assert_eq!( + // Solution::search( + // vec![ + // 1004, 1005, 1006, 1007, 1008, 1009, 1010, 1011, 1012, 0, 1, 2, 3, 4, 5, 6, 7, 8 + // ], + // 1006 + // ), + // 2 + // ); + // assert_eq!(Solution::search(vec![4, 5, 6, 7, 0, 1, 2], 3), -1); + // assert_eq!(Solution::search(vec![], 3), -1); + assert_eq!(Solution::search(vec![5,1,3], 5), 0); + } +} diff --git a/src/problem/p0034_find_first_and_last_position_of_element_in_sorted_array.rs b/src/problem/p0034_find_first_and_last_position_of_element_in_sorted_array.rs new file mode 100644 index 00000000..b351096f --- /dev/null +++ b/src/problem/p0034_find_first_and_last_position_of_element_in_sorted_array.rs @@ -0,0 +1,82 @@ +/** + * [34] Find First and Last Position of Element in Sorted Array + * + * Given an array of integers nums sorted in ascending order, find the starting and ending position of a given target value. + * If target is not found in the array, return [-1, -1]. + * Follow up: Could you write an algorithm with O(log n) runtime complexity? + * + * Example 1: + * Input: nums = [5,7,7,8,8,10], target = 8 + * Output: [3,4] + * Example 2: + * Input: nums = [5,7,7,8,8,10], target = 6 + * Output: [-1,-1] + * Example 3: + * Input: nums = [], target = 0 + * Output: [-1,-1] + * + * Constraints: + * + * 0 <= nums.length <= 10^5 + * -10^9 <= nums[i] <= 10^9 + * nums is a non-decreasing array. + * -10^9 <= target <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/find-first-and-last-position-of-element-in-sorted-array/ +// discuss: https://leetcode.com/problems/find-first-and-last-position-of-element-in-sorted-array/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + // Return -1 if no such element found. + // end_pos exclusive + pub fn last_smaller(nums: &Vec, start_pos: usize, end_pos: usize, target: i32) -> i32 { + if target <= nums[start_pos] { + -1 + } else if start_pos == end_pos - 1 { + start_pos as i32 + } else { + let mid = (start_pos + end_pos) / 2; + let mid_num = nums[mid as usize]; + if target <= mid_num { + Self::last_smaller(nums, start_pos, mid, target) + } else { + Self::last_smaller(nums, mid, end_pos, target) + } + } + } + + pub fn search_range(nums: Vec, target: i32) -> Vec { + if nums.len() == 0 { + return vec![-1, -1]; + } + + let high_idx = Self::last_smaller(&nums, 0, nums.len(), target+1); + + if high_idx != -1 && nums[high_idx as usize] == target { + // low_idx can be -1 + let low_idx = Self::last_smaller(&nums, 0, nums.len(), target); + vec![low_idx+1, high_idx] + } else { + vec![-1, -1] + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_34() { + assert_eq!(Solution::search_range(vec![5,7,7,8,8,10], 8), vec![3,4]); + assert_eq!(Solution::search_range(vec![5,7,7,8,8,10], 6), vec![-1,-1]); + assert_eq!(Solution::search_range(vec![], 0), vec![-1,-1]); + + } +} diff --git a/src/problem/p0036_valid_sudoku.rs b/src/problem/p0036_valid_sudoku.rs new file mode 100644 index 00000000..b3ffef9c --- /dev/null +++ b/src/problem/p0036_valid_sudoku.rs @@ -0,0 +1,141 @@ +/** + * [36] Valid Sudoku + * + * Determine if a 9 x 9 Sudoku board is valid. Only the filled cells need to be validated according to the following rules: + *
    + * Each row must contain the digits 1-9 without repetition. + * Each column must contain the digits 1-9 without repetition. + * Each of the nine 3 x 3 sub-boxes of the grid must contain the digits 1-9 without repetition. + *
+ * Note: + * + * A Sudoku board (partially filled) could be valid but is not necessarily solvable. + * Only the filled cells need to be validated according to the mentioned rules. + * + * + * Example 1: + * + * Input: board = + * [["5","3",".",".","7",".",".",".","."] + * ,["6",".",".","1","9","5",".",".","."] + * ,[".","9","8",".",".",".",".","6","."] + * ,["8",".",".",".","6",".",".",".","3"] + * ,["4",".",".","8",".","3",".",".","1"] + * ,["7",".",".",".","2",".",".",".","6"] + * ,[".","6",".",".",".",".","2","8","."] + * ,[".",".",".","4","1","9",".",".","5"] + * ,[".",".",".",".","8",".",".","7","9"]] + * Output: true + * + * Example 2: + * + * Input: board = + * [["8","3",".",".","7",".",".",".","."] + * ,["6",".",".","1","9","5",".",".","."] + * ,[".","9","8",".",".",".",".","6","."] + * ,["8",".",".",".","6",".",".",".","3"] + * ,["4",".",".","8",".","3",".",".","1"] + * ,["7",".",".",".","2",".",".",".","6"] + * ,[".","6",".",".",".",".","2","8","."] + * ,[".",".",".","4","1","9",".",".","5"] + * ,[".",".",".",".","8",".",".","7","9"]] + * Output: false + * Explanation: Same as Example 1, except with the 5 in the top left corner being modified to 8. Since there are two 8's in the top left 3x3 sub-box, it is invalid. + * + * + * Constraints: + * + * board.length == 9 + * board[i].length == 9 + * board[i][j] is a digit or '.'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/valid-sudoku/ +// discuss: https://leetcode.com/problems/valid-sudoku/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashSet; + +impl Solution { + pub fn is_valid_sudoku(board: Vec>) -> bool { + for i in 0..9 { + let mut presence : HashSet = HashSet::new(); + for j in 0..9 { + if board[i][j] == '.' {continue;} + if presence.contains(&board[i][j]) { + return false; + } + presence.insert(board[i][j]); + } + } + + for j in 0..9 { + let mut presence : HashSet = HashSet::new(); + for i in 0..9 { + if board[i][j] == '.' {continue;} + if presence.contains(&board[i][j]) { + return false; + } + presence.insert(board[i][j]); + } + } + + for row_group in 0..3 { + for col_group in 0..3 { + let mut presence : HashSet = HashSet::new(); + for i in (row_group * 3)..((row_group+1)*3) { + for j in (col_group * 3)..((col_group+1)*3) { + if board[i][j] == '.' {continue;} + if presence.contains(&board[i][j]) { + return false; + } + presence.insert(board[i][j]); + } + } + } + } + + true + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_36() { + assert_eq!( + Solution::is_valid_sudoku(vec![ + vec!['8', '3', '.', '.', '7', '.', '.', '.', '.'], + vec!['6', '.', '.', '1', '9', '5', '.', '.', '.'], + vec!['.', '9', '8', '.', '.', '.', '.', '6', '.'], + vec!['8', '.', '.', '.', '6', '.', '.', '.', '3'], + vec!['4', '.', '.', '8', '.', '3', '.', '.', '1'], + vec!['7', '.', '.', '.', '2', '.', '.', '.', '6'], + vec!['.', '6', '.', '.', '.', '.', '2', '8', '.'], + vec!['.', '.', '.', '4', '1', '9', '.', '.', '5'], + vec!['.', '.', '.', '.', '8', '.', '.', '7', '9'], + ]), + false + ); + assert_eq!( + Solution::is_valid_sudoku(vec![ + vec!['5', '3', '.', '.', '7', '.', '.', '.', '.'], + vec!['6', '.', '.', '1', '9', '5', '.', '.', '.'], + vec!['.', '9', '8', '.', '.', '.', '.', '6', '.'], + vec!['8', '.', '.', '.', '6', '.', '.', '.', '3'], + vec!['4', '.', '.', '8', '.', '3', '.', '.', '1'], + vec!['7', '.', '.', '.', '2', '.', '.', '.', '6'], + vec!['.', '6', '.', '.', '.', '.', '2', '8', '.'], + vec!['.', '.', '.', '4', '1', '9', '.', '.', '5'], + vec!['.', '.', '.', '.', '8', '.', '.', '7', '9'] + ]), + true + ); + } +} diff --git a/src/problem/p0037_sudoku_solver.rs b/src/problem/p0037_sudoku_solver.rs new file mode 100644 index 00000000..747cca09 --- /dev/null +++ b/src/problem/p0037_sudoku_solver.rs @@ -0,0 +1,102 @@ +/** + * [37] Sudoku Solver + * + * Write a program to solve a Sudoku puzzle by filling the empty cells. + * A sudoku solution must satisfy all of the following rules: + *
    + * Each of the digits 1-9 must occur exactly once in each row. + * Each of the digits 1-9 must occur exactly once in each column. + * Each of the digits 1-9 must occur exactly once in each of the 9 3x3 sub-boxes of the grid. + *
+ * The '.' character indicates empty cells. + * + * Example 1: + * + * Input: board = [["5","3",".",".","7",".",".",".","."],["6",".",".","1","9","5",".",".","."],[".","9","8",".",".",".",".","6","."],["8",".",".",".","6",".",".",".","3"],["4",".",".","8",".","3",".",".","1"],["7",".",".",".","2",".",".",".","6"],[".","6",".",".",".",".","2","8","."],[".",".",".","4","1","9",".",".","5"],[".",".",".",".","8",".",".","7","9"]] + * Output: [["5","3","4","6","7","8","9","1","2"],["6","7","2","1","9","5","3","4","8"],["1","9","8","3","4","2","5","6","7"],["8","5","9","7","6","1","4","2","3"],["4","2","6","8","5","3","7","9","1"],["7","1","3","9","2","4","8","5","6"],["9","6","1","5","3","7","2","8","4"],["2","8","7","4","1","9","6","3","5"],["3","4","5","2","8","6","1","7","9"]] + * Explanation: The input board is shown above and the only valid solution is shown below: + * + * + * + * Constraints: + * + * board.length == 9 + * board[i].length == 9 + * board[i][j] is a digit or '.'. + * It is guaranteed that the input board has only one solution. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/sudoku-solver/ +// discuss: https://leetcode.com/problems/sudoku-solver/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn is_valid(board: &Vec>, i : usize, j : usize, try_char : char) -> bool { + for col in 0..9 { + if board[i][col] == try_char {return false;} + } + for row in 0..9 { + if board[row][j] == try_char {return false;} + } + + let row_group_idx = i / 3; + let col_group_idx = j / 3; + for ii in (3 * row_group_idx)..(3*(row_group_idx+1)) { + for jj in (3 * col_group_idx)..(3*(col_group_idx+1)) { + if board[ii][jj] == try_char {return false;} + } + } + true + } + + pub fn recursive_solve(board: &mut Vec>, all_missed_cells : &Vec<(usize, usize)>, cur_idx : usize) -> bool { + if cur_idx == all_missed_cells.len() { + return true; + } + + let i : usize = all_missed_cells[cur_idx].0; + let j : usize = all_missed_cells[cur_idx].1; + + for &c in ['1','2','3','4','5','6','7','8','9'].iter() { + if !Self::is_valid(board, i,j,c) {continue}; + board[i][j] = c; + if Self::recursive_solve(board, all_missed_cells, cur_idx + 1) {return true;} + // This step is compulsory: when all options fail, it resets before backtracking. + board[i][j] = '.'; + } + false + } + + pub fn solve_sudoku(board: &mut Vec>) { + let mut all_missed_cells : Vec<(usize, usize)> = vec![]; + for i in 0..9 { + for j in 0..9 { + if board[i][j] == '.' { + all_missed_cells.push((i,j)); + } + } + } + Self::recursive_solve(board, &all_missed_cells, 0); + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_37() { + let mut board : Vec> = vec![vec!['5','3','.','.','7','.','.','.','.'],vec!['6','.','.','1','9','5','.','.','.'],vec!['.','9','8','.','.','.','.','6','.'],vec!['8','.','.','.','6','.','.','.','3'],vec!['4','.','.','8','.','3','.','.','1'],vec!['7','.','.','.','2','.','.','.','6'],vec!['.','6','.','.','.','.','2','8','.'],vec!['.','.','.','4','1','9','.','.','5'],vec!['.','.','.','.','8','.','.','7','9']]; + + let output : Vec> = vec![vec!['5','3','4','6','7','8','9','1','2'],vec!['6','7','2','1','9','5','3','4','8'],vec!['1','9','8','3','4','2','5','6','7'],vec!['8','5','9','7','6','1','4','2','3'],vec!['4','2','6','8','5','3','7','9','1'],vec!['7','1','3','9','2','4','8','5','6'],vec!['9','6','1','5','3','7','2','8','4'],vec!['2','8','7','4','1','9','6','3','5'],vec!['3','4','5','2','8','6','1','7','9']]; + + Solution::solve_sudoku(&mut board); + assert_eq!(board, output); + + } +} diff --git a/src/problem/p0038_count_and_say.rs b/src/problem/p0038_count_and_say.rs new file mode 100644 index 00000000..ded760b6 --- /dev/null +++ b/src/problem/p0038_count_and_say.rs @@ -0,0 +1,88 @@ +/** + * [38] Count and Say + * + * The count-and-say sequence is a sequence of digit strings defined by the recursive formula: + * + * countAndSay(1) = "1" + * countAndSay(n) is the way you would "say" the digit string from countAndSay(n-1), which is then converted into a different digit string. + * + * To determine how you "say" a digit string, split it into the minimal number of groups so that each group is a contiguous section all of the same character. Then for each group, say the number of characters, then say the character. To convert the saying into a digit string, replace the counts with a number and concatenate every saying. + * For example, the saying and conversion for digit string "3322251": + * + * Given a positive integer n, return the n^th term of the count-and-say sequence. + * + * Example 1: + * + * Input: n = 1 + * Output: "1" + * Explanation: This is the base case. + * + * Example 2: + * + * Input: n = 4 + * Output: "1211" + * Explanation: + * countAndSay(1) = "1" + * countAndSay(2) = say "1" = one 1 = "11" + * countAndSay(3) = say "11" = two 1's = "21" + * countAndSay(4) = say "21" = one 2 + one 1 = "12" + "11" = "1211" + * + * + * Constraints: + * + * 1 <= n <= 30 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/count-and-say/ +// discuss: https://leetcode.com/problems/count-and-say/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn step(mut digits : Vec) -> Vec { + let mut result : Vec = vec![]; + + let mut last_digit : char = digits[0]; + let mut last_count : u8 = 1; + for i in 1..digits.len() { + if last_digit != digits[i] { + result.push(last_digit); + result.push((last_count + '0' as u8) as char); + + last_digit = digits[i]; + last_count = 1; + } else { + last_count +=1; + } + } + result.push(last_digit); + result.push((last_count + '0' as u8) as char); + + result + } + pub fn count_and_say(n: i32) -> String { + let mut result : Vec = vec!['1']; + for i in 1..n{ + result = Self::step(result); + } + result.into_iter().rev().collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_38() { + assert_eq!(Solution::count_and_say(1), "1"); + assert_eq!(Solution::count_and_say(2), "11"); + assert_eq!(Solution::count_and_say(3), "21"); + assert_eq!(Solution::count_and_say(4), "1211"); + assert_eq!(Solution::count_and_say(5), "111221"); + } +} diff --git a/src/problem/p0039_combination_sum.rs b/src/problem/p0039_combination_sum.rs new file mode 100644 index 00000000..6d17d6d3 --- /dev/null +++ b/src/problem/p0039_combination_sum.rs @@ -0,0 +1,122 @@ +/** + * [39] Combination Sum + * + * Given an array of distinct integers candidates and a target integer target, return a list of all unique combinations of candidates where the chosen numbers sum to target. You may return the combinations in any order. + * The same number may be chosen from candidates an unlimited number of times. Two combinations are unique if the frequency of at least one of the chosen numbers is different. + * It is guaranteed that the number of unique combinations that sum up to target is less than 150 combinations for the given input. + * + * Example 1: + * + * Input: candidates = [2,3,6,7], target = 7 + * Output: [[2,2,3],[7]] + * Explanation: + * 2 and 3 are candidates, and 2 + 2 + 3 = 7. Note that 2 can be used multiple times. + * 7 is a candidate, and 7 = 7. + * These are the only two combinations. + * + * Example 2: + * + * Input: candidates = [2,3,5], target = 8 + * Output: [[2,2,2,2],[2,3,3],[3,5]] + * + * Example 3: + * + * Input: candidates = [2], target = 1 + * Output: [] + * + * Example 4: + * + * Input: candidates = [1], target = 1 + * Output: [[1]] + * + * Example 5: + * + * Input: candidates = [1], target = 2 + * Output: [[1,1]] + * + * + * Constraints: + * + * 1 <= candidates.length <= 30 + * 1 <= candidates[i] <= 200 + * All elements of candidates are distinct. + * 1 <= target <= 500 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/combination-sum/ +// discuss: https://leetcode.com/problems/combination-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn backtrack_helper

(result : &mut Vec>, tmp : &mut Vec, elements : &Vec, predicate: P, start : usize, no_dup : bool, element_reusable : bool) where P:Fn(&Vec)->(bool, bool) + Copy { + // is_sorted() is only supported in nightly-built rust + // if no_dup && !elements.is_sorted() { + // panic!("Elements must be presorted to deduplicate."); + // } + let (valid , backtrack) = predicate(tmp); + if valid { + result.push(tmp.clone()); + } + if backtrack { + let n : usize = elements.len(); + for i in start..n { + let backtrack : bool = if !no_dup {true} else if i==start{true}else if elements[i-1] != elements[i] {true}else{false}; + + if backtrack { + tmp.push(elements[i]); + let next_start = if element_reusable { i } else { i+1 }; + Self::backtrack_helper(result, tmp, elements, predicate, next_start, no_dup, element_reusable); + tmp.pop(); + } + } + } + } + + pub fn combination_sum(candidates: Vec, target: i32) -> Vec> { + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let element_reusable = true; + let no_dup = false; + + let predicate = |tmp : &Vec|{ + let mut valid = false; + let mut backtrack = false; + let sum : i32 = tmp.iter().sum(); + if sum < target { + backtrack = true; + } else if sum == target { + valid = true; + } + (valid, backtrack) + }; + + Self::backtrack_helper(&mut result, &mut tmp, &candidates, predicate, 0, no_dup, element_reusable); + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_39() { + assert_eq!( + Solution::combination_sum(vec![1], 7), + vec![vec![1, 1, 1, 1, 1, 1, 1]] + ); + assert_eq!( + Solution::combination_sum(vec![2, 3, 6, 7], 7), + vec![vec![2, 2, 3], vec![7]] + ); + assert_eq!( + Solution::combination_sum(vec![2, 3, 5], 8), + vec![vec![2, 2, 2, 2], vec![2, 3, 3], vec![3, 5]] + ); + } +} diff --git a/src/problem/p0040_combination_sum_ii.rs b/src/problem/p0040_combination_sum_ii.rs new file mode 100644 index 00000000..2a0bc4af --- /dev/null +++ b/src/problem/p0040_combination_sum_ii.rs @@ -0,0 +1,113 @@ +/** + * [40] Combination Sum II + * + * Given a collection of candidate numbers (candidates) and a target number (target), find all unique combinations in candidates where the candidate numbers sum to target. + * Each number in candidates may only be used once in the combination. + * Note: The solution set must not contain duplicate combinations. + * + * Example 1: + * + * Input: candidates = [10,1,2,7,6,1,5], target = 8 + * Output: + * [ + * [1,1,6], + * [1,2,5], + * [1,7], + * [2,6] + * ] + * + * Example 2: + * + * Input: candidates = [2,5,2,1,2], target = 5 + * Output: + * [ + * [1,2,2], + * [5] + * ] + * + * + * Constraints: + * + * 1 <= candidates.length <= 100 + * 1 <= candidates[i] <= 50 + * 1 <= target <= 30 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/combination-sum-ii/ +// discuss: https://leetcode.com/problems/combination-sum-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn backtrack_helper

(result : &mut Vec>, tmp : &mut Vec, elements : &Vec, predicate: P, start : usize, no_dup : bool, element_reusable : bool) where P:Fn(&Vec)->(bool, bool) + Copy { + // is_sorted() is only supported in nightly-built rust + // if no_dup && !elements.is_sorted() { + // panic!("Elements must be presorted to deduplicate."); + // } + let (valid , backtrack) = predicate(tmp); + if valid { + result.push(tmp.clone()); + } + if backtrack { + let n : usize = elements.len(); + for i in start..n { + let backtrack : bool = if !no_dup {true} else if i==start{true}else if elements[i-1] != elements[i] {true}else{false}; + + if backtrack { + tmp.push(elements[i]); + let next_start = if element_reusable { i } else { i+1 }; + Self::backtrack_helper(result, tmp, elements, predicate, next_start, no_dup, element_reusable); + tmp.pop(); + } + } + } + } + + pub fn combination_sum2(mut candidates: Vec, target: i32) -> Vec> { + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let element_reusable = false; + let no_dup = true; + candidates.sort(); + + let predicate = |tmp : &Vec|{ + let mut valid = false; + let mut backtrack = false; + let sum : i32 = tmp.iter().sum(); + if sum < target { + backtrack = true; + } else if sum == target { + valid = true; + } + (valid, backtrack) + }; + + Self::backtrack_helper(&mut result, &mut tmp, &candidates, predicate, 0, no_dup, element_reusable); + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_40() { + assert_eq!( + Solution::combination_sum2(vec![1, 1, 1, 1, 1, 1, 1], 7), + vec![vec![1, 1, 1, 1, 1, 1, 1]] + ); + assert_eq!( + Solution::combination_sum2(vec![10, 1, 2, 7, 6, 1, 5], 8), + vec![vec![1, 1, 6], vec![1, 2, 5], vec![1, 7], vec![2, 6]] + ); + assert_eq!( + Solution::combination_sum2(vec![2, 5, 2, 1, 2], 5), + vec![vec![1, 2, 2], vec![5]] + ); + } +} diff --git a/src/problem/p0041_first_missing_positive.rs b/src/problem/p0041_first_missing_positive.rs new file mode 100644 index 00000000..5319c03b --- /dev/null +++ b/src/problem/p0041_first_missing_positive.rs @@ -0,0 +1,83 @@ +/** + * [41] First Missing Positive + * + * Given an unsorted integer array nums, find the smallest missing positive integer. + * + * Example 1: + * Input: nums = [1,2,0] + * Output: 3 + * Example 2: + * Input: nums = [3,4,-1,1] + * Output: 2 + * Example 3: + * Input: nums = [7,8,9,11,12] + * Output: 1 + * + * Constraints: + * + * 1 <= nums.length <= 300 + * -2^31 <= nums[i] <= 2^31 - 1 + * + * + * Follow up: Could you implement an algorithm that runs in O(n) time and uses constant extra space? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/first-missing-positive/ +// discuss: https://leetcode.com/problems/first-missing-positive/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn first_missing_positive(nums: Vec) -> i32 { + let mut bit_set : Vec = vec![0u64;5]; + + for &num in nums.iter() { + if num <= 0 {continue;} + let num = num as usize; + let set_idx : usize = num / 64; + if set_idx >= 5 {continue;} + let bit_idx : usize = num % 64; + bit_set[set_idx] |= 1 << bit_idx; + } + + for bit_pos in 1..=301 { + let set_idx : usize = bit_pos / 64; + let bit_idx : usize = bit_pos % 64; + if bit_set[set_idx] & (1 << bit_idx) == 0 { + return bit_pos as i32; + } + + } + panic!("Shall not reach here..."); + 0 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_41() { + assert_eq!(Solution::first_missing_positive(vec![2, 2]), 1); + assert_eq!( + Solution::first_missing_positive(vec![12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2]), + 1 + ); + assert_eq!( + Solution::first_missing_positive(vec![2, 2, 2, 2, 2, 2, 2]), + 1 + ); + assert_eq!(Solution::first_missing_positive(vec![3, 4, -1, 1]), 2); + assert_eq!(Solution::first_missing_positive(vec![2, 1, 0]), 3); + assert_eq!(Solution::first_missing_positive(vec![7, 8, 9, 11, 12]), 1); + assert_eq!( + Solution::first_missing_positive(vec![7, 8, 1, 2, 3, 3, 3, 3, 3, 3, 3, -5, -7, 1234]), + 4 + ); + } +} diff --git a/src/problem/p0042_trapping_rain_water.rs b/src/problem/p0042_trapping_rain_water.rs new file mode 100644 index 00000000..6ce1c332 --- /dev/null +++ b/src/problem/p0042_trapping_rain_water.rs @@ -0,0 +1,73 @@ +/** + * [42] Trapping Rain Water + * + * Given n non-negative integers representing an elevation map where the width of each bar is 1, compute how much water it can trap after raining. + * + * Example 1: + * + * Input: height = [0,1,0,2,1,0,1,3,2,1,2,1] + * Output: 6 + * Explanation: The above elevation map (black section) is represented by array [0,1,0,2,1,0,1,3,2,1,2,1]. In this case, 6 units of rain water (blue section) are being trapped. + * + * Example 2: + * + * Input: height = [4,2,0,3,2,5] + * Output: 9 + * + * + * Constraints: + * + * n == height.length + * 0 <= n <= 3 * 10^4 + * 0 <= height[i] <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/trapping-rain-water/ +// discuss: https://leetcode.com/problems/trapping-rain-water/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn trap(heights: Vec) -> i32 { + let n = heights.len(); + + let mut left_max = vec![-1i32;n]; //exclusive of its own + let mut cur_left_max = 0; + for i in 0..n { + if cur_left_max <= heights[i] { + cur_left_max = heights[i]; + } + left_max[i] = cur_left_max; + } + + let mut right_max = vec![-1i32;n]; + let mut cur_right_max = 0; + for i in (0..n).rev() { + if cur_right_max < heights[i] { + cur_right_max = heights[i]; + } + right_max[i] = cur_right_max; + } + + let mut sum : i32 = 0; + for i in 0..n { + let min_height = std::cmp::min(left_max[i], right_max[i]); + if min_height > heights[i] { + sum += min_height - heights[i]; + } + } + sum + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_42() {} +} diff --git a/src/problem/p0043_multiply_strings.rs b/src/problem/p0043_multiply_strings.rs new file mode 100644 index 00000000..613b7fc9 --- /dev/null +++ b/src/problem/p0043_multiply_strings.rs @@ -0,0 +1,91 @@ +/** + * [43] Multiply Strings + * + * Given two non-negative integers num1 and num2 represented as strings, return the product of num1 and num2, also represented as a string. + * Note: You must not use any built-in BigInteger library or convert the inputs to integer directly. + * + * Example 1: + * Input: num1 = "2", num2 = "3" + * Output: "6" + * Example 2: + * Input: num1 = "123", num2 = "456" + * Output: "56088" + * + * Constraints: + * + * 1 <= num1.length, num2.length <= 200 + * num1 and num2 consist of digits only. + * Both num1 and num2 do not contain any leading zero, except the number 0 itself. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/multiply-strings/ +// discuss: https://leetcode.com/problems/multiply-strings/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn add(num1 : &Vec, num2 : &Vec) -> Vec { + let mut carry : u8 = 0; + let mut result : Vec = vec![]; + let mut i : usize = 0; + while carry != 0 || i < num1.len() || i < num2.len() { + let mut num1_digit : u8 = 0; + let mut num2_digit : u8 = 0; + if i < num1.len() { num1_digit = num1[i]; } + if i < num2.len() { num2_digit = num2[i]; } + let this_digit : u8 = (num1_digit + num2_digit + carry) % 10; + carry = (num1_digit + num2_digit + carry) / 10; + + result.push(this_digit); + i+=1; + } + result + } + + pub fn mul(num : &Vec, digit : u8, base : usize) -> Vec { + let mut result : Vec = vec![0u8;base]; + let mut carry : u8 = 0; + let mut i : usize = 0; + while carry != 0 || i < num.len(){ + let mut num_digit : u8 = 0; + if i < num.len() { num_digit = num[i]; } + let this_digit : u8 = (num_digit * digit + carry) % 10; + carry = (num_digit * digit + carry) / 10; + + result.push(this_digit); + i+=1; + } + result + } + + pub fn multiply(num1: String, num2: String) -> String { + if num1 == "0" || num2 == "0" { return "0".to_owned(); } + + let num1 : Vec = num1.chars().map(|c : char|{c as u8 - '0' as u8}).rev().collect(); + let num2 : Vec = num2.chars().map(|c : char|{c as u8 - '0' as u8}).rev().collect(); + let mut result : Vec = vec![]; + // println!("num1={:?}", num1); + for (i, &num2_digit) in num2.iter().enumerate() { + let this_mul : Vec = Self::mul(&num1, num2_digit, i); + // println!("i={}, this_mul={:?}", i, this_mul); + result = Self::add(&result, &this_mul); + } + result.into_iter().rev().map(|c|{(c + '0' as u8) as char}).collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_43() { + assert_eq!(Solution::multiply("2".to_owned(), "3".to_owned()), "6".to_owned()); + assert_eq!(Solution::multiply("123".to_owned(), "456".to_owned()), "56088".to_owned()); + assert_eq!(Solution::multiply("9133".to_owned(), "0".to_owned()), "0".to_owned()); + } +} diff --git a/src/problem/p0044_wildcard_matching.rs b/src/problem/p0044_wildcard_matching.rs new file mode 100644 index 00000000..0624cd95 --- /dev/null +++ b/src/problem/p0044_wildcard_matching.rs @@ -0,0 +1,98 @@ +/** + * [44] Wildcard Matching + * + * Given an input string (s) and a pattern (p), implement wildcard pattern matching with support for '?' and '*' where: + * + * '?' Matches any single character. + * '*' Matches any sequence of characters (including the empty sequence). + * + * The matching should cover the entire input string (not partial). + * + * Example 1: + * + * Input: s = "aa", p = "a" + * Output: false + * Explanation: "a" does not match the entire string "aa". + * + * Example 2: + * + * Input: s = "aa", p = "*" + * Output: true + * Explanation: '*' matches any sequence. + * + * Example 3: + * + * Input: s = "cb", p = "?a" + * Output: false + * Explanation: '?' matches 'c', but the second letter is 'a', which does not match 'b'. + * + * Example 4: + * + * Input: s = "adceb", p = "*a*b" + * Output: true + * Explanation: The first '*' matches the empty sequence, while the second '*' matches the substring "dce". + * + * Example 5: + * + * Input: s = "acdcb", p = "a*c?b" + * Output: false + * + * + * Constraints: + * + * 0 <= s.length, p.length <= 2000 + * s contains only lowercase English letters. + * p contains only lowercase English letters, '?' or '*'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/wildcard-matching/ +// discuss: https://leetcode.com/problems/wildcard-matching/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn is_match(s: String, p: String) -> bool { + let s : Vec = s.chars().collect(); + let p : Vec = p.chars().collect(); + let mut matches = vec![vec![false;p.len()+1];s.len()+1]; + matches[0][0] = true; + for j in 1..=p.len() { + if p[j-1] == '*' { + matches[0][j] = true; + } else { + break; + } + } + + for i in 1..=s.len() { + for j in 1..=p.len() { + if p[j-1] == '?' { + matches[i][j] = matches[i-1][j-1]; + } else if p[j-1] == '*' { + matches[i][j] = matches[i][j-1] || matches[i-1][j]; + } else { + matches[i][j] = matches[i-1][j-1] && s[i-1] == p[j-1]; + } + } + } + matches[s.len()][p.len()] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_44() { + assert!(!Solution::is_match("aa".to_owned(), "a".to_owned())); + assert!(Solution::is_match("aa".to_owned(), "*".to_owned())); + assert!(!Solution::is_match("cb".to_owned(), "*a".to_owned())); + assert!(Solution::is_match("adceb".to_owned(), "*a*b".to_owned())); + assert!(!Solution::is_match("acdcb".to_owned(), "a*c?b".to_owned())); + } +} diff --git a/src/problem/p0046_permutations.rs b/src/problem/p0046_permutations.rs new file mode 100644 index 00000000..02be4506 --- /dev/null +++ b/src/problem/p0046_permutations.rs @@ -0,0 +1,80 @@ +/** + * [46] Permutations + * + * Given an array nums of distinct integers, return all the possible permutations. You can return the answer in any order. + * + * Example 1: + * Input: nums = [1,2,3] + * Output: [[1,2,3],[1,3,2],[2,1,3],[2,3,1],[3,1,2],[3,2,1]] + * Example 2: + * Input: nums = [0,1] + * Output: [[0,1],[1,0]] + * Example 3: + * Input: nums = [1] + * Output: [[1]] + * + * Constraints: + * + * 1 <= nums.length <= 6 + * -10 <= nums[i] <= 10 + * All the integers of nums are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/permutations/ +// discuss: https://leetcode.com/problems/permutations/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn helper(nums: &mut Vec, start_pos : usize, end_pos : usize) -> Vec> { + if start_pos == end_pos { + return vec![vec![]]; + } + let mut my_perms : Vec> = vec![]; + for i in start_pos..end_pos { + nums.swap(start_pos, i); + let mut prev_perms = Self::helper(nums, start_pos+1, end_pos); + + for prev_perm in &mut prev_perms { + let mut my_perm = vec![nums[start_pos]]; + my_perm.append(prev_perm); + // println!("\t myperm: {:?}", my_perm); + my_perms.push(my_perm); + } + + nums.swap(start_pos, i); + } + // println!("nums: {:?}, start_pos: {}, perm: {:?}", nums, start_pos, my_perms); + // println!(""); + my_perms + } + + pub fn permute(mut nums: Vec) -> Vec> { + let l = nums.len(); + Self::helper(&mut nums, 0, l) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_46() { + assert_eq!( + Solution::permute(vec![1, 2, 3]), + vec![ + vec![3, 2, 1], + vec![2, 3, 1], + vec![3, 1, 2], + vec![1, 3, 2], + vec![2, 1, 3], + vec![1, 2, 3], + ] + ) + } +} diff --git a/src/problem/p0047_permutations_ii.rs b/src/problem/p0047_permutations_ii.rs new file mode 100644 index 00000000..3b33d974 --- /dev/null +++ b/src/problem/p0047_permutations_ii.rs @@ -0,0 +1,188 @@ +/** + * [47] Permutations II + * + * Given a collection of numbers, nums, that might contain duplicates, return all possible unique permutations in any order. + * + * Example 1: + * + * Input: nums = [1,1,2] + * Output: + * [[1,1,2], + * [1,2,1], + * [2,1,1]] + * + * Example 2: + * + * Input: nums = [1,2,3] + * Output: [[1,2,3],[1,3,2],[2,1,3],[2,3,1],[3,1,2],[3,2,1]] + * + * + * Constraints: + * + * 1 <= nums.length <= 8 + * -10 <= nums[i] <= 10 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/permutations-ii/ +// discuss: https://leetcode.com/problems/permutations-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::{collections::HashSet, mem::swap}; + +impl Solution { + pub fn helper(nums: &mut Vec, start_pos : usize, end_pos : usize) -> Vec> { + if start_pos == end_pos { + return vec![vec![]]; + } + let mut my_perms : Vec> = vec![]; + let mut swapped = HashSet::new(); + for i in start_pos..end_pos { + if swapped.contains(&nums[i]) { + continue; + } + swapped.insert(nums[i]); + + nums.swap(start_pos, i); + let mut prev_perms = Self::helper(nums, start_pos+1, end_pos); + + for prev_perm in &mut prev_perms { + let mut my_perm = vec![nums[start_pos]]; + my_perm.append(prev_perm); + // println!("\t myperm: {:?}", my_perm); + my_perms.push(my_perm); + } + + nums.swap(start_pos, i); + } + // println!("nums: {:?}, start_pos: {}, perm: {:?}", nums, start_pos, my_perms); + // println!(""); + my_perms + } + + pub fn permute(mut nums: Vec) -> Vec> { + let l = nums.len(); + Self::helper(&mut nums, 0, l) + } +} +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_47() { + assert_eq!( + Solution::permute(vec![1, 1, 2]), + vec![vec![2, 1, 1], vec![1, 2, 1], vec![1, 1, 2],] + ); + assert_eq!(Solution::permute(vec![1, 1, 1]), vec![vec![1, 1, 1],]); + assert_eq!( + Solution::permute(vec![1, 1, 1, 2]), + vec![ + vec![2, 1, 1, 1], + vec![1, 2, 1, 1], + vec![1, 1, 2, 1], + vec![1, 1, 1, 2], + ] + ); + assert_eq!( + Solution::permute(vec![1, 1, 2, 2, 3, 3]), + vec![ + vec![3, 3, 2, 2, 1, 1], + vec![3, 2, 3, 2, 1, 1], + vec![2, 3, 3, 2, 1, 1], + vec![3, 2, 2, 3, 1, 1], + vec![2, 3, 2, 3, 1, 1], + vec![2, 2, 3, 3, 1, 1], + vec![3, 3, 2, 1, 2, 1], + vec![3, 2, 3, 1, 2, 1], + vec![2, 3, 3, 1, 2, 1], + vec![3, 3, 1, 2, 2, 1], + vec![3, 1, 3, 2, 2, 1], + vec![1, 3, 3, 2, 2, 1], + vec![3, 2, 1, 3, 2, 1], + vec![2, 3, 1, 3, 2, 1], + vec![3, 1, 2, 3, 2, 1], + vec![1, 3, 2, 3, 2, 1], + vec![2, 1, 3, 3, 2, 1], + vec![1, 2, 3, 3, 2, 1], + vec![3, 2, 2, 1, 3, 1], + vec![2, 3, 2, 1, 3, 1], + vec![2, 2, 3, 1, 3, 1], + vec![3, 2, 1, 2, 3, 1], + vec![2, 3, 1, 2, 3, 1], + vec![3, 1, 2, 2, 3, 1], + vec![1, 3, 2, 2, 3, 1], + vec![2, 1, 3, 2, 3, 1], + vec![1, 2, 3, 2, 3, 1], + vec![2, 2, 1, 3, 3, 1], + vec![2, 1, 2, 3, 3, 1], + vec![1, 2, 2, 3, 3, 1], + vec![3, 3, 2, 1, 1, 2], + vec![3, 2, 3, 1, 1, 2], + vec![2, 3, 3, 1, 1, 2], + vec![3, 3, 1, 2, 1, 2], + vec![3, 1, 3, 2, 1, 2], + vec![1, 3, 3, 2, 1, 2], + vec![3, 2, 1, 3, 1, 2], + vec![2, 3, 1, 3, 1, 2], + vec![3, 1, 2, 3, 1, 2], + vec![1, 3, 2, 3, 1, 2], + vec![2, 1, 3, 3, 1, 2], + vec![1, 2, 3, 3, 1, 2], + vec![3, 3, 1, 1, 2, 2], + vec![3, 1, 3, 1, 2, 2], + vec![1, 3, 3, 1, 2, 2], + vec![3, 1, 1, 3, 2, 2], + vec![1, 3, 1, 3, 2, 2], + vec![1, 1, 3, 3, 2, 2], + vec![3, 2, 1, 1, 3, 2], + vec![2, 3, 1, 1, 3, 2], + vec![3, 1, 2, 1, 3, 2], + vec![1, 3, 2, 1, 3, 2], + vec![2, 1, 3, 1, 3, 2], + vec![1, 2, 3, 1, 3, 2], + vec![3, 1, 1, 2, 3, 2], + vec![1, 3, 1, 2, 3, 2], + vec![1, 1, 3, 2, 3, 2], + vec![2, 1, 1, 3, 3, 2], + vec![1, 2, 1, 3, 3, 2], + vec![1, 1, 2, 3, 3, 2], + vec![3, 2, 2, 1, 1, 3], + vec![2, 3, 2, 1, 1, 3], + vec![2, 2, 3, 1, 1, 3], + vec![3, 2, 1, 2, 1, 3], + vec![2, 3, 1, 2, 1, 3], + vec![3, 1, 2, 2, 1, 3], + vec![1, 3, 2, 2, 1, 3], + vec![2, 1, 3, 2, 1, 3], + vec![1, 2, 3, 2, 1, 3], + vec![2, 2, 1, 3, 1, 3], + vec![2, 1, 2, 3, 1, 3], + vec![1, 2, 2, 3, 1, 3], + vec![3, 2, 1, 1, 2, 3], + vec![2, 3, 1, 1, 2, 3], + vec![3, 1, 2, 1, 2, 3], + vec![1, 3, 2, 1, 2, 3], + vec![2, 1, 3, 1, 2, 3], + vec![1, 2, 3, 1, 2, 3], + vec![3, 1, 1, 2, 2, 3], + vec![1, 3, 1, 2, 2, 3], + vec![1, 1, 3, 2, 2, 3], + vec![2, 1, 1, 3, 2, 3], + vec![1, 2, 1, 3, 2, 3], + vec![1, 1, 2, 3, 2, 3], + vec![2, 2, 1, 1, 3, 3], + vec![2, 1, 2, 1, 3, 3], + vec![1, 2, 2, 1, 3, 3], + vec![2, 1, 1, 2, 3, 3], + vec![1, 2, 1, 2, 3, 3], + vec![1, 1, 2, 2, 3, 3] + ] + ); + } +} diff --git a/src/problem/p0048_rotate_image.rs b/src/problem/p0048_rotate_image.rs new file mode 100644 index 00000000..d7a44a05 --- /dev/null +++ b/src/problem/p0048_rotate_image.rs @@ -0,0 +1,109 @@ +/** + * [48] Rotate Image + * + * You are given an n x n 2D matrix representing an image, rotate the image by 90 degrees (clockwise). + * You have to rotate the image in-place, which means you have to modify the input 2D matrix directly. DO NOT allocate another 2D matrix and do the rotation. + * + * Example 1: + * + * Input: matrix = [[1,2,3],[4,5,6],[7,8,9]] + * Output: [[7,4,1],[8,5,2],[9,6,3]] + * + * Example 2: + * + * Input: matrix = [[5,1,9,11],[2,4,8,10],[13,3,6,7],[15,14,12,16]] + * Output: [[15,13,2,5],[14,3,4,1],[12,6,8,9],[16,7,10,11]] + * + * Example 3: + * + * Input: matrix = [[1]] + * Output: [[1]] + * + * Example 4: + * + * Input: matrix = [[1,2],[3,4]] + * Output: [[3,1],[4,2]] + * + * + * Constraints: + * + * matrix.length == n + * matrix[i].length == n + * 1 <= n <= 20 + * -1000 <= matrix[i][j] <= 1000 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/rotate-image/ +// discuss: https://leetcode.com/problems/rotate-image/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn rotate(matrix: &mut Vec>) { + let n : usize = matrix.len(); + for i in 0..n-1 { + for j in i..(n-1-i) { + let past0 : i32 = matrix[i][j]; + let past1 : i32 = matrix[j][n-1-i]; + let past2 : i32 = matrix[n-1-i][n-1-j]; + let past3 : i32 = matrix[n-1-j][i]; + + matrix[j][n-1-i] = past0; + matrix[n-1-i][n-1-j] = past1; + matrix[n-1-j][i] = past2; + matrix[i][j] = past3; + } + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_48() { + let mut matrix = vec![ + vec![5, 1, 9, 11], + vec![2, 4, 8, 10], + vec![13, 3, 6, 7], + vec![15, 14, 12, 16], + ]; + Solution::rotate(&mut matrix); + assert_eq!( + matrix, + vec![ + vec![15, 13, 2, 5], + vec![14, 3, 4, 1], + vec![12, 6, 8, 9], + vec![16, 7, 10, 11] + ] + ); + + + + + let mut matrix = vec![ + vec![1,2,3], + vec![4,5,6], + vec![7,8,9], + ]; + Solution::rotate(&mut matrix); + assert_eq!( + matrix, + vec![ + vec![7, 4, 1], + vec![8, 5, 2], + vec![9, 6, 3], + ] + ); + + + + + } +} diff --git a/src/problem/p0049_group_anagrams.rs b/src/problem/p0049_group_anagrams.rs new file mode 100644 index 00000000..7385ec29 --- /dev/null +++ b/src/problem/p0049_group_anagrams.rs @@ -0,0 +1,74 @@ +/** + * [49] Group Anagrams + * + * Given an array of strings strs, group the anagrams together. You can return the answer in any order. + * An Anagram is a word or phrase formed by rearranging the letters of a different word or phrase, typically using all the original letters exactly once. + * + * Example 1: + * Input: strs = ["eat","tea","tan","ate","nat","bat"] + * Output: [["bat"],["nat","tan"],["ate","eat","tea"]] + * Example 2: + * Input: strs = [""] + * Output: [[""]] + * Example 3: + * Input: strs = ["a"] + * Output: [["a"]] + * + * Constraints: + * + * 1 <= strs.length <= 10^4 + * 0 <= strs[i].length <= 100 + * strs[i] consists of lower-case English letters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/group-anagrams/ +// discuss: https://leetcode.com/problems/group-anagrams/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn group_anagrams(strs: Vec) -> Vec> { + let mut dedup: HashMap> = HashMap::new(); + for str in strs { + let mut chars: Vec = str.chars().collect(); + chars.sort_by(|a, b| a.cmp(b)); + let s : String = chars.into_iter().collect(); + if let Some(x) = dedup.get_mut(&s) { + x.push(str); + } else { + dedup.insert(s, vec![str]); + } + } + let mut result = vec![]; + + for (_, r) in dedup { + result.push(r); + } + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + use std::collections::HashSet; + // TODO: implement arbitrary match macro + #[test] + #[ignore] + fn test_49() { + assert_eq!( + Solution::group_anagrams(vec_string!["eat", "tea", "tan", "ate", "nat", "bat"]), + vec![ + vec_string!["tan", "nat"], + vec_string!["bat"], + vec_string!["eat", "ate", "tea"], + ] + ); + } +} diff --git a/src/problem/p0050_powx_n.rs b/src/problem/p0050_powx_n.rs new file mode 100644 index 00000000..276cf4b0 --- /dev/null +++ b/src/problem/p0050_powx_n.rs @@ -0,0 +1,78 @@ +/** + * [50] Pow(x, n) + * + * Implement pow(x, n), which calculates x raised to the power n (i.e., x^n). + * + * Example 1: + * + * Input: x = 2.00000, n = 10 + * Output: 1024.00000 + * + * Example 2: + * + * Input: x = 2.10000, n = 3 + * Output: 9.26100 + * + * Example 3: + * + * Input: x = 2.00000, n = -2 + * Output: 0.25000 + * Explanation: 2^-2 = 1/2^2 = 1/4 = 0.25 + * + * + * Constraints: + * + * -100.0 < x < 100.0 + * -2^31 <= n <= 2^31-1 + * -10^4 <= x^n <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/powx-n/ +// discuss: https://leetcode.com/problems/powx-n/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn my_pow(mut x: f64, mut n: i32) -> f64 { + let mut n : i64 = n as i64; + let neg : bool = n < 0; + if neg { + n=-n; + } + + let mut result : f64 = 1.0; + while n != 0 { + // println!("n={}", n); + if n % 2 == 1{ + result *= x; + } + x = x * x; + n = n >> 1; + } + if neg { + 1.0 / result + } else { + result + } + // f64::powi(x, n) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_50() { + assert_eq!(Solution::my_pow(2.0, -2), 0.25); + assert_eq!(Solution::my_pow(2.0, 4), 16.0); + assert_eq!(Solution::my_pow(2.0, 5), 32.0); + assert_eq!(Solution::my_pow(2.0, 1), 2.0); + assert_eq!(Solution::my_pow(2.0, -1), 0.5); + assert_eq!(Solution::my_pow(2.0, 10), 1024.0); + } +} diff --git a/src/problem/p0051_n_queens.rs b/src/problem/p0051_n_queens.rs new file mode 100644 index 00000000..50e08d4f --- /dev/null +++ b/src/problem/p0051_n_queens.rs @@ -0,0 +1,100 @@ +/** + * [51] N-Queens + * + * The n-queens puzzle is the problem of placing n queens on an n x n chessboard such that no two queens attack each other. + * Given an integer n, return all distinct solutions to the n-queens puzzle. + * Each solution contains a distinct board configuration of the n-queens' placement, where 'Q' and '.' both indicate a queen and an empty space, respectively. + * + * Example 1: + * + * Input: n = 4 + * Output: [[".Q..","...Q","Q...","..Q."],["..Q.","Q...","...Q",".Q.."]] + * Explanation: There exist two distinct solutions to the 4-queens puzzle as shown above + * + * Example 2: + * + * Input: n = 1 + * Output: [["Q"]] + * + * + * Constraints: + * + * 1 <= n <= 9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/n-queens/ +// discuss: https://leetcode.com/problems/n-queens/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn helper(cur_assign: &mut Vec<(i32, i32)>, n : i32) -> Vec> { + // println!("Cur_assign = {:?}", cur_assign); + let mut results = vec![]; + if cur_assign.len() == n as usize { + // a valid assignment + let mut result = vec![]; + for (row, col) in cur_assign.clone() { + let mut pattern: Vec = (0..n).map(|_| '.').collect(); + pattern[col as usize] = 'Q'; + result.push(pattern.into_iter().collect()); + } + results.push(result); + } else { + for col in 0..n { + let row = cur_assign.len() as i32; + let mut valid = true; + for (prev_row, prev_col) in cur_assign.clone() { + if prev_col == col { + // same column + valid = false; + continue; + } + if prev_row - prev_col == row - col { + // same \\ diagonal + valid = false; + continue; + } + if prev_row + prev_col == row + col { + // same // diagonal + valid = false; + continue; + } + } + + if valid { + cur_assign.push((row, col)); + results.append(&mut Self::helper(cur_assign, n)); + cur_assign.pop(); + } + } + } + + results + } + pub fn solve_n_queens(n: i32) -> Vec> { + let mut pos = vec![]; + Self::helper(&mut pos, n) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_51() { + assert_eq!( + Solution::solve_n_queens(4), + vec![ + vec![".Q..", "...Q", "Q...", "..Q."], + vec!["..Q.", "Q...", "...Q", ".Q.."] + ] + ); + assert_eq!(Solution::solve_n_queens(8).len(), 92); + } +} diff --git a/src/problem/p0052_n_queens_ii.rs b/src/problem/p0052_n_queens_ii.rs new file mode 100644 index 00000000..ae6a358e --- /dev/null +++ b/src/problem/p0052_n_queens_ii.rs @@ -0,0 +1,89 @@ +/** + * [52] N-Queens II + * + * The n-queens puzzle is the problem of placing n queens on an n x n chessboard such that no two queens attack each other. + * Given an integer n, return the number of distinct solutions to the n-queens puzzle. + * + * Example 1: + * + * Input: n = 4 + * Output: 2 + * Explanation: There are two distinct solutions to the 4-queens puzzle as shown. + * + * Example 2: + * + * Input: n = 1 + * Output: 1 + * + * + * Constraints: + * + * 1 <= n <= 9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/n-queens-ii/ +// discuss: https://leetcode.com/problems/n-queens-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn recursive_try(board : &mut Vec>, row_idx : usize) -> usize { + let size : usize = board.len(); + if row_idx == size {return 1;} + let mut sol_count : usize = 0; + for col_idx in 0..size { + let mut valid = true; + // check the validity at (row_idx, col_idx) + let mut i = 0; + + while valid && i < row_idx { + // Same column in previous row + if board[i][col_idx] {valid = false;} + + // Same / diagonal in previous row + let j : i32 = row_idx as i32 + col_idx as i32 - i as i32; + if 0 <= j && j < size as i32 { + if board[i][j as usize] {valid = false;} + } + + // Same \ diagonal in previous row : + // row_idx - col_idx = i - j; + let j : i32 = i as i32 + col_idx as i32 - row_idx as i32; + if 0 <= j && j < size as i32 { + if board[i][j as usize] {valid = false;} + } + i+=1; + } + + if valid { + board[row_idx][col_idx] = true; + sol_count += Self::recursive_try(board, row_idx + 1); + board[row_idx][col_idx] = false; + } + } + sol_count + } + + pub fn total_n_queens(n: i32) -> i32 { + let n = n as usize; + let mut board : Vec> = vec![vec![false; n];n]; + Self::recursive_try(&mut board, 0) as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_52() { + assert_eq!(Solution::total_n_queens(4), 2); + assert_eq!(Solution::total_n_queens(8), 92); + // assert_eq!(Solution::total_n_queens(13), 73712); + // assert_eq!(Solution::total_n_queens(14), 365596); + } +} diff --git a/src/problem/p0053_maximum_subarray.rs b/src/problem/p0053_maximum_subarray.rs new file mode 100644 index 00000000..e01e8fb0 --- /dev/null +++ b/src/problem/p0053_maximum_subarray.rs @@ -0,0 +1,74 @@ +/** + * [53] Maximum Subarray + * + * Given an integer array nums, find the contiguous subarray (containing at least one number) which has the largest sum and return its sum. + * + * Example 1: + * + * Input: nums = [-2,1,-3,4,-1,2,1,-5,4] + * Output: 6 + * Explanation: [4,-1,2,1] has the largest sum = 6. + * + * Example 2: + * + * Input: nums = [1] + * Output: 1 + * + * Example 3: + * + * Input: nums = [5,4,-1,7,8] + * Output: 23 + * + * + * Constraints: + * + * 1 <= nums.length <= 3 * 10^4 + * -10^5 <= nums[i] <= 10^5 + * + * + * Follow up: If you have figured out the O(n) solution, try coding another solution using the divide and conquer approach, which is more subtle. + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/maximum-subarray/ +// discuss: https://leetcode.com/problems/maximum-subarray/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn max_sub_array(nums: Vec) -> i32 { + let mut max_sum = -100000; + let mut last_sum = -1; // the sum of max array ending at i-1 element, in each iteration. + for num in nums { + let my_sum : i32; // the sum of max array ending at this element. + if last_sum < 0 { + // It is better to give up with the previous array + my_sum = num; + } else { + // It is better to concat with the previous array + my_sum = last_sum + num; + } + max_sum = std::cmp::max(max_sum, my_sum); + last_sum = my_sum; + } + max_sum + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_53() { + assert_eq!( + Solution::max_sub_array(vec![-2, 1, -3, 4, -1, 2, 1, -5, 4]), + 6 + ); + assert_eq!(Solution::max_sub_array(vec![-8]), -8); + assert_eq!(Solution::max_sub_array(vec![-8, -2]), -2); + assert_eq!(Solution::max_sub_array(vec![5,4,-1,7,8]), 23); + } +} diff --git a/src/problem/p0054_spiral_matrix.rs b/src/problem/p0054_spiral_matrix.rs new file mode 100644 index 00000000..74ba8e47 --- /dev/null +++ b/src/problem/p0054_spiral_matrix.rs @@ -0,0 +1,107 @@ +/** + * [54] Spiral Matrix + * + * Given an m x n matrix, return all elements of the matrix in spiral order. + * + * Example 1: + * + * Input: matrix = [[1,2,3],[4,5,6],[7,8,9]] + * Output: [1,2,3,6,9,8,7,4,5] + * + * Example 2: + * + * Input: matrix = [[1,2,3,4],[5,6,7,8],[9,10,11,12]] + * Output: [1,2,3,4,8,12,11,10,9,5,6,7] + * + * + * Constraints: + * + * m == matrix.length + * n == matrix[i].length + * 1 <= m, n <= 10 + * -100 <= matrix[i][j] <= 100 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/spiral-matrix/ +// discuss: https://leetcode.com/problems/spiral-matrix/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn spiral_order(matrix: Vec>) -> Vec { + let mut result = vec![]; + let row_count = matrix.len() as i32; + let col_count = matrix[0].len() as i32; + + let mut top = 0i32; + let mut bottom = (row_count - 1) as i32; + let mut left = 0i32; + let mut right = (col_count - 1) as i32; + + loop { + for j in left..=right { + result.push(matrix[top as usize][j as usize]); + } + // if left > right || top > bottom { + // break; + // } + if result.len() as i32 == row_count * col_count { + break; + } + top += 1; + + for i in top..=bottom { + result.push(matrix[i as usize][right as usize]); + } + if result.len() as i32 == row_count * col_count { + break; + } + right -= 1; + + for j in (left..=right).rev() { + result.push(matrix[bottom as usize][j as usize]); + } + if result.len() as i32 == row_count * col_count { + break; + } + bottom-=1; + + for i in (top..=bottom).rev() { + result.push(matrix[i as usize][left as usize]); + } + if result.len() as i32 == row_count * col_count { + break; + } + left +=1; + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_54() { + + assert_eq!( + Solution::spiral_order(vec![vec![1, 2, 3], vec![4, 5, 6], vec![7, 8, 9]]), + vec![1, 2, 3, 6, 9, 8, 7, 4, 5] + ); + assert_eq!(Solution::spiral_order(vec![vec![1, 2, 3]]), vec![1, 2, 3]); + assert_eq!( + Solution::spiral_order(vec![vec![1], vec![2], vec![3],]), + vec![1, 2, 3] + ); + assert_eq!(Solution::spiral_order(vec![vec![1],]), vec![1]); + assert_eq!( + Solution::spiral_order(vec![vec![1, 2], vec![4, 5],]), + vec![1, 2, 5, 4] + ); + } +} diff --git a/src/problem/p0055_jump_game.rs b/src/problem/p0055_jump_game.rs new file mode 100644 index 00000000..2bda5a94 --- /dev/null +++ b/src/problem/p0055_jump_game.rs @@ -0,0 +1,74 @@ +/** + * [55] Jump Game + * + * Given an array of non-negative integers nums, you are initially positioned at the first index of the array. + * Each element in the array represents your maximum jump length at that position. + * Determine if you are able to reach the last index. + * + * Example 1: + * + * Input: nums = [2,3,1,1,4] + * Output: true + * Explanation: Jump 1 step from index 0 to 1, then 3 steps to the last index. + * + * Example 2: + * + * Input: nums = [3,2,1,0,4] + * Output: false + * Explanation: You will always arrive at index 3 no matter what. Its maximum jump length is 0, which makes it impossible to reach the last index. + * + * + * Constraints: + * + * 1 <= nums.length <= 10^4 + * 0 <= nums[i] <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/jump-game/ +// discuss: https://leetcode.com/problems/jump-game/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn can_jump(nums: Vec) -> bool { + let mut cur_pos : usize = 0; + let mut max_pos : usize = cur_pos + nums[cur_pos] as usize; + while max_pos < nums.len() - 1 { + // println!("cur_pos={}, max_pos={}", cur_pos, max_pos); + let mut next_max_pos : usize = 0; + for pos in (cur_pos+1)..=max_pos { + next_max_pos = std::cmp::max(next_max_pos, pos + nums[pos] as usize); + } + if max_pos == next_max_pos { + return false; + } else { + cur_pos = max_pos; + max_pos = next_max_pos; + } + } + true + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_55() { + assert_eq!(Solution::can_jump(vec![2, 3, 1, 1, 4]), true); + assert_eq!(Solution::can_jump(vec![3, 2, 1, 0, 4]), false); + assert_eq!(Solution::can_jump(vec![2, 3, 1, 1, 0, 0, 0, 4]), false); + assert_eq!(Solution::can_jump(vec![8, 3, 1, 1, 0, 0, 0, 4]), true); + assert_eq!(Solution::can_jump(vec![0]), true); + assert_eq!(Solution::can_jump(vec![1, 1, 2, 2, 0, 1, 1]), true); + assert_eq!( + Solution::can_jump(vec![1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 0]), + true + ); + } +} diff --git a/src/problem/p0056_merge_intervals.rs b/src/problem/p0056_merge_intervals.rs new file mode 100644 index 00000000..d35231aa --- /dev/null +++ b/src/problem/p0056_merge_intervals.rs @@ -0,0 +1,63 @@ +/** + * [56] Merge Intervals + * + * Given an array of intervals where intervals[i] = [starti, endi], merge all overlapping intervals, and return an array of the non-overlapping intervals that cover all the intervals in the input. + * + * Example 1: + * + * Input: intervals = [[1,3],[2,6],[8,10],[15,18]] + * Output: [[1,6],[8,10],[15,18]] + * Explanation: Since intervals [1,3] and [2,6] overlaps, merge them into [1,6]. + * + * Example 2: + * + * Input: intervals = [[1,4],[4,5]] + * Output: [[1,5]] + * Explanation: Intervals [1,4] and [4,5] are considered overlapping. + * + * + * Constraints: + * + * 1 <= intervals.length <= 10^4 + * intervals[i].length == 2 + * 0 <= starti <= endi <= 10^4 + * + */ + + +pub struct Solution {} + +// problem: https://leetcode.com/problems/merge-intervals/ +// discuss: https://leetcode.com/problems/merge-intervals/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn merge(intervals: Vec>) -> Vec> { + let mut intervals = intervals; + intervals.sort_by(|a,b| a[0].partial_cmp(&b[0]).unwrap()); + + let mut result = vec![]; + let len = intervals.len(); + if 0 < len { + let mut cur_interval = intervals[0].clone(); + for i in 1..len { + let cur_end = cur_interval[1]; + let next_start = intervals[i][0]; + let next_end = intervals[i][1]; + if (next_end < cur_end) { + continue; + } else if cur_end < next_start { + result.push(cur_interval); + cur_interval = intervals[i].clone(); + } else { + cur_interval[1] = next_end; + } + } + result.push(cur_interval); + } + result + } +} + +// submission codes end \ No newline at end of file diff --git a/src/problem/p0057_insert_interval.rs b/src/problem/p0057_insert_interval.rs new file mode 100644 index 00000000..842370e2 --- /dev/null +++ b/src/problem/p0057_insert_interval.rs @@ -0,0 +1,154 @@ +/** + * [57] Insert Interval + * + * Given a set of non-overlapping intervals, insert a new interval into the intervals (merge if necessary). + * You may assume that the intervals were initially sorted according to their start times. + * + * Example 1: + * + * Input: intervals = [[1,3],[6,9]], newInterval = [2,5] + * Output: [[1,5],[6,9]] + * + * Example 2: + * + * Input: intervals = [[1,2],[3,5],[6,7],[8,10],[12,16]], newInterval = [4,8] + * Output: [[1,2],[3,10],[12,16]] + * Explanation: Because the new interval [4,8] overlaps with [3,5],[6,7],[8,10]. + * Example 3: + * + * Input: intervals = [], newInterval = [5,7] + * Output: [[5,7]] + * + * Example 4: + * + * Input: intervals = [[1,5]], newInterval = [2,3] + * Output: [[1,5]] + * + * Example 5: + * + * Input: intervals = [[1,5]], newInterval = [2,7] + * Output: [[1,7]] + * + * + * Constraints: + * + * 0 <= intervals.length <= 10^4 + * intervals[i].length == 2 + * 0 <= intervals[i][0] <= intervals[i][1] <= 10^5 + * intervals is sorted by intervals[i][0] in ascending order. + * newInterval.length == 2 + * 0 <= newInterval[0] <= newInterval[1] <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/insert-interval/ +// discuss: https://leetcode.com/problems/insert-interval/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn insert(intervals: Vec>, new_interval: Vec) -> Vec> { + let mut result : Vec> = vec![]; + let mut i : usize = 0; + let len : usize = intervals.len(); + const START : usize = 0usize; + const END : usize = 1usize; + while i < len && intervals[i][END] < new_interval[START] { + result.push(intervals[i].clone()); + i+=1; + } + if i == len { + // all intervals ends before this new one + result.push(new_interval); + return result; + } + + let new_start : i32 = std::cmp::min(intervals[i][START], new_interval[START]); + + while i < len && intervals[i][START] <= new_interval[END] { + i+=1; + } + let mut new_end : i32 = new_interval[END]; + if 0 < i { + i-=1; // the idx of the last interval that intervals[i].start <= new_interval[end] + new_end = std::cmp::max(intervals[i][END], new_interval[END]); + i+=1; + } + // println!("i={}", i); + result.push(vec![new_start, new_end]); + + while i < len { + result.push(intervals[i].clone()); + i+=1; + } + result + } +} + +pub struct Interval {} + +// problem: https://leetcode.com/problems/insert-interval/ +// discuss: https://leetcode.com/problems/insert-interval/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Interval { + fn new(start : i32, end : i32) -> Vec { + vec![start, end] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_57() { + assert_eq!( + Solution::insert( + vec![Interval::new(1, 3), Interval::new(6, 9)], + Interval::new(2, 5) + ), + vec![Interval::new(1, 5), Interval::new(6, 9)] + ); + assert_eq!( + Solution::insert( + vec![ + Interval::new(1, 2), + Interval::new(3, 5), + Interval::new(6, 7), + Interval::new(8, 10), + Interval::new(12, 16) + ], + Interval::new(4, 8) + ), + vec![ + Interval::new(1, 2), + Interval::new(3, 10), + Interval::new(12, 16) + ] + ); + assert_eq!( + Solution::insert(vec![Interval::new(3, 4)], Interval::new(1, 2)), + vec![Interval::new(1, 2), Interval::new(3, 4)] + ); + assert_eq!( + Solution::insert(vec![Interval::new(1, 2)], Interval::new(3, 4)), + vec![Interval::new(1, 2), Interval::new(3, 4)] + ); + assert_eq!( + Solution::insert(vec![Interval::new(1, 2)], Interval::new(2, 3)), + vec![Interval::new(1, 3)] + ); + assert_eq!( + Solution::insert( + vec![Interval::new(1, 2), Interval::new(3, 4)], + Interval::new(0, 6) + ), + vec![Interval::new(0, 6)] + ); + } +} diff --git a/src/problem/p0059_spiral_matrix_ii.rs b/src/problem/p0059_spiral_matrix_ii.rs new file mode 100644 index 00000000..ed9c6c06 --- /dev/null +++ b/src/problem/p0059_spiral_matrix_ii.rs @@ -0,0 +1,96 @@ +/** + * [59] Spiral Matrix II + * + * Given a positive integer n, generate an n x n matrix filled with elements from 1 to n^2 in spiral order. + * + * Example 1: + * + * Input: n = 3 + * Output: [[1,2,3],[8,9,4],[7,6,5]] + * + * Example 2: + * + * Input: n = 1 + * Output: [[1]] + * + * + * Constraints: + * + * 1 <= n <= 20 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/spiral-matrix-ii/ +// discuss: https://leetcode.com/problems/spiral-matrix-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn generate_matrix(n: i32) -> Vec> { + let mut matrix = vec![vec![0;n as usize];n as usize]; + let row_count = n; + let col_count = n; + + let mut top = 0i32; + let mut bottom = (row_count - 1) as i32; + let mut left = 0i32; + let mut right = (col_count - 1) as i32; + + let mut num = 1; + + loop { + // println!("A top={}, bottom={}, left={}, right={}", top, bottom, left, right); + for j in left..=right { + matrix[top as usize][j as usize] = num; + num += 1; + } + top += 1; + if left > right || top > bottom { + break; + } + + // println!("B top={}, bottom={}, left={}, right={}", top, bottom, left, right); + for i in top..=bottom { + matrix[i as usize][right as usize] = num; + num += 1; + } + right-=1; + if left > right || top > bottom {break} + + // println!("C top={}, bottom={}, left={}, right={}", top, bottom, left, right); + for j in (left..=right).rev() { + matrix[bottom as usize][j as usize] = num; + num += 1; + } + bottom -=1; + if left > right || top > bottom {break} + + // println!("D top={}, bottom={}, left={}, right={}", top, bottom, left, right); + for i in (top..=bottom).rev() { + matrix[i as usize][left as usize] = num; + num +=1 ; + } + left+=1; + if left > right || top > bottom {break} + } + matrix + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_59() { + assert_eq!(Solution::generate_matrix(1), vec![vec![1]]); + assert_eq!(Solution::generate_matrix(2), vec![vec![1, 2], vec![4, 3]]); + assert_eq!( + Solution::generate_matrix(3), + vec![vec![1, 2, 3], vec![8, 9, 4], vec![7, 6, 5],] + ); + } +} diff --git a/src/problem/p0060_permutation_sequence.rs b/src/problem/p0060_permutation_sequence.rs new file mode 100644 index 00000000..5f68d804 --- /dev/null +++ b/src/problem/p0060_permutation_sequence.rs @@ -0,0 +1,120 @@ +/** + * [60] Permutation Sequence + * + * The set [1, 2, 3, ..., n] contains a total of n! unique permutations. + * By listing and labeling all of the permutations in order, we get the following sequence for n = 3: + *

    + * "123" + * "132" + * "213" + * "231" + * "312" + * "321" + *
+ * Given n and k, return the k^th permutation sequence. + * + * Example 1: + * Input: n = 3, k = 3 + * Output: "213" + * Example 2: + * Input: n = 4, k = 9 + * Output: "2314" + * Example 3: + * Input: n = 3, k = 1 + * Output: "123" + * + * Constraints: + * + * 1 <= n <= 9 + * 1 <= k <= n! + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/permutation-sequence/ +// discuss: https://leetcode.com/problems/permutation-sequence/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn get_helper(factorial : &Vec, nums : &mut Vec, k : usize, n : usize) -> Vec { + // Optional Short-cut to avoid recursive. + // if k == 0 { + // return nums.iter().filter(|&&c|{c!='0'}).cloned().collect(); + // } + if n == 0 {return vec![];} + let i : usize = n - 1; + let idx : usize = k / factorial[i]; + let c_ptr : &mut char = nums.iter_mut().filter(|c|{**c!='0'}).nth(idx).unwrap(); + let mut result : String = c_ptr.to_string(); + + let mut result : Vec = vec![*c_ptr]; + *c_ptr = '0'; // Mark this num/char has been taken + let next_k = k % factorial[i]; + result.extend(Self::get_helper(factorial, nums, next_k, n - 1)); + return result; + } + + pub fn get_permutation_backup(n: i32, k: i32) -> String { + let n = n as usize; + let mut nums : Vec = vec![]; + for i in 1..=n { + nums.push(('1' as u8 + (i-1) as u8) as char); + } + let mut k : usize = (k - 1) as usize;// make the idex starting from 0 + let mut factorial : Vec = vec![1;10]; + for i in 1..=9 { + factorial[i] = i * factorial[i-1]; + } + + Self::get_helper(&factorial, &mut nums, k, n).iter().collect() + } + + pub fn recursive(factorials : &mut Vec, k : i32, nums : &mut Vec) -> String { + if nums.iter().filter(|&&x|{x!=-1}).next().is_none() { + return "".to_owned(); + } + + let last_factorial : i32 = factorials.pop().unwrap(); + let nth_max : i32 = k / last_factorial; + let this_digit : String = nums.iter().filter(|&&x|{x!=-1}).nth(nth_max as usize).unwrap().to_string(); + *nums.iter_mut().filter(|x|{**x!=-1}).nth(nth_max as usize).unwrap() = -1; + + let k = k % last_factorial; + this_digit + &Self::recursive(factorials, k % last_factorial, nums) + } + + pub fn get_permutation(n: i32, k: i32) -> String { + let k : i32 = k - 1; + let mut factorials : Vec = vec![1]; + let mut factorial : i32 = 1; + for i in 1..n { + factorial *= i as i32; + factorials.push(factorial); + } + + let mut nums : Vec = vec![]; + for i in (1..=n) { + nums.push(i as i32); + } + + Self::recursive(&mut factorials, k, &mut nums) + } + +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_60() { + assert_eq!(Solution::get_permutation(4, 9), "2314".to_owned()); + assert_eq!(Solution::get_permutation(3, 3), "213".to_owned()); + assert_eq!(Solution::get_permutation(3, 1), "123".to_owned()); + assert_eq!(Solution::get_permutation(3, 2), "132".to_owned()); + assert_eq!(Solution::get_permutation(2, 2), "21".to_owned()); + } +} diff --git a/src/problem/p0061_rotate_list.rs b/src/problem/p0061_rotate_list.rs new file mode 100644 index 00000000..4a854b8d --- /dev/null +++ b/src/problem/p0061_rotate_list.rs @@ -0,0 +1,121 @@ +/** + * [61] Rotate List + * + * Given the head of a linked list, rotate the list to the right by k places. + * + * Example 1: + * + * Input: head = [1,2,3,4,5], k = 2 + * Output: [4,5,1,2,3] + * + * Example 2: + * + * Input: head = [0,1,2], k = 4 + * Output: [2,0,1] + * + * + * Constraints: + * + * The number of nodes in the list is in the range [0, 500]. + * -100 <= Node.val <= 100 + * 0 <= k <= 2 * 10^9 + * + */ +pub struct Solution {} +use std::borrow::BorrowMut; + +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/rotate-list/ +// discuss: https://leetcode.com/problems/rotate-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn rotate_right(head: Option>, k: i32) -> Option> { + if let None = head { + return None; + } + let mut head = head; + let mut k_ahead = head.as_ref().unwrap(); + let mut ki = k; + let mut l = 1; + // k_ahead points to the k-th node with head as 0-th, possibly rotating. + while 0 < ki { + match(k_ahead.next) { + None => { + break; + }, + Some(ref node) => { + k_ahead = node + } + } + ki-=1; + l+=1; + } + + // Count the steps to advance k_ahead until k_ahead is the last + let mut steps_to_tail = 0; // f + if ki == 0 { + while k_ahead.next.is_some() { + steps_to_tail+=1; + k_ahead = k_ahead.next.as_ref().unwrap(); + } + } else { + steps_to_tail = l - k % l - 1; + } + // println!("l = {}, k = {}, steps_to_tail = {}", l, k, steps_to_tail); + + // Advance new_tail to the steps_to_tail-th node. + let mut new_tail = head.as_mut().unwrap(); + for i in 0..steps_to_tail { + new_tail = new_tail.next.as_mut().unwrap(); + } + + // does not rotate at all, due to k = list.len. + if new_tail.as_ref().next.is_none() { + return head; + } + + let mut new_head = new_tail.next.take(); + let mut old_tail = new_head.as_mut().unwrap(); + while old_tail.next.is_some() { + old_tail = old_tail.next.as_mut().unwrap(); + } + + old_tail.next = head; + return new_head; + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_61() { + assert_eq!( + Solution::rotate_right(linked![0, 1, 2], 4), + linked![2, 0, 1] + ); + + } +} diff --git a/src/problem/p0062_unique_paths.rs b/src/problem/p0062_unique_paths.rs new file mode 100644 index 00000000..7eb9da4a --- /dev/null +++ b/src/problem/p0062_unique_paths.rs @@ -0,0 +1,90 @@ +/** + * [62] Unique Paths + * + * A robot is located at the top-left corner of a m x n grid (marked 'Start' in the diagram below). + * The robot can only move either down or right at any point in time. The robot is trying to reach the bottom-right corner of the grid (marked 'Finish' in the diagram below). + * How many possible unique paths are there? + * + * Example 1: + * + * Input: m = 3, n = 7 + * Output: 28 + * + * Example 2: + * + * Input: m = 3, n = 2 + * Output: 3 + * Explanation: + * From the top-left corner, there are a total of 3 ways to reach the bottom-right corner: + * 1. Right -> Down -> Down + * 2. Down -> Down -> Right + * 3. Down -> Right -> Down + * + * Example 3: + * + * Input: m = 7, n = 3 + * Output: 28 + * + * Example 4: + * + * Input: m = 3, n = 3 + * Output: 6 + * + * + * Constraints: + * + * 1 <= m, n <= 100 + * It's guaranteed that the answer will be less than or equal to 2 * 10^9. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/unique-paths/ +// discuss: https://leetcode.com/problems/unique-paths/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn unique_paths(m: i32, n: i32) -> i32 { + // m : depth + // n : width + let mut v: Vec> = (0..m) + .map(|_| + (0..n) + .map(|_| 0) + .collect() + ).collect(); + // println!("depth = {}, width = {}, m = {}, n = {}", v.len(), v[0].len(), m, n); + + for i in 0..m { + for j in 0..n { + let i = i as usize; + let j = j as usize; + if i == 0 || j == 0 { + println!("i = {}, j = {}", i, j) ; + v[i][j] = 1; + } else { + v[i][j] = v[i-1][j] + v[i][j-1]; + } + } + } + + v[(m-1) as usize][(n-1) as usize] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_62() { + assert_eq!(Solution::unique_paths(7, 3), 28); + assert_eq!(Solution::unique_paths(3, 7), 28); + assert_eq!(Solution::unique_paths(1, 1), 1); + assert_eq!(Solution::unique_paths(2, 2), 2); + assert_eq!(Solution::unique_paths(36, 7), 4496388); + } +} diff --git a/src/problem/p0063_unique_paths_ii.rs b/src/problem/p0063_unique_paths_ii.rs new file mode 100644 index 00000000..0b055f03 --- /dev/null +++ b/src/problem/p0063_unique_paths_ii.rs @@ -0,0 +1,111 @@ +/** + * [63] Unique Paths II + * + * A robot is located at the top-left corner of a m x n grid (marked 'Start' in the diagram below). + * The robot can only move either down or right at any point in time. The robot is trying to reach the bottom-right corner of the grid (marked 'Finish' in the diagram below). + * Now consider if some obstacles are added to the grids. How many unique paths would there be? + * An obstacle and space is marked as 1 and 0 respectively in the grid. + * + * Example 1: + * + * Input: obstacleGrid = [[0,0,0],[0,1,0],[0,0,0]] + * Output: 2 + * Explanation: There is one obstacle in the middle of the 3x3 grid above. + * There are two ways to reach the bottom-right corner: + * 1. Right -> Right -> Down -> Down + * 2. Down -> Down -> Right -> Right + * + * Example 2: + * + * Input: obstacleGrid = [[0,1],[0,0]] + * Output: 1 + * + * + * Constraints: + * + * m == obstacleGrid.length + * n == obstacleGrid[i].length + * 1 <= m, n <= 100 + * obstacleGrid[i][j] is 0 or 1. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/unique-paths-ii/ +// discuss: https://leetcode.com/problems/unique-paths-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn unique_paths_with_obstacles(obstacle_grid: Vec>) -> i32 { + let row_count : usize = obstacle_grid.len(); + let col_count : usize = obstacle_grid[0].len(); + if obstacle_grid[row_count-1][col_count-1] == 1 { + return 0; + } + + let mut path_count : Vec> = vec![vec![0;col_count];row_count]; + path_count[row_count-1][col_count-1] = 1; + for i in (0..row_count).rev() { + for j in (0..col_count).rev() { + if i == row_count - 1 && j == col_count - 1 {continue} + if obstacle_grid[i][j] == 1 {continue} + let mut right_path_count : i32 = 0; + if j < col_count - 1 && obstacle_grid[i][j+1] == 0 { + right_path_count = path_count[i][j+1]; + } + + let mut down_path_count : i32 = 0; + if i < row_count - 1 && obstacle_grid[i+1][j] == 0 { + down_path_count = path_count[i+1][j]; + } + path_count[i][j] = down_path_count + right_path_count; + } + } + path_count[0][0] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_63() { + assert_eq!(Solution::unique_paths_with_obstacles(vec![vec![0]]), 1); + assert_eq!( + Solution::unique_paths_with_obstacles(vec![vec![0, 0], vec![0, 0],]), + 2 + ); + assert_eq!( + Solution::unique_paths_with_obstacles(vec![vec![0, 1], vec![1, 0],]), + 0 + ); + assert_eq!( + Solution::unique_paths_with_obstacles(vec![ + vec![0, 0, 0], + vec![0, 1, 0], + vec![0, 0, 0], + ]), + 2 + ); + assert_eq!( + Solution::unique_paths_with_obstacles(vec![ + vec![0, 0, 0, 0], + vec![0, 0, 0, 0], + vec![0, 0, 0, 0], + ]), + 10 + ); + assert_eq!( + Solution::unique_paths_with_obstacles(vec![ + vec![0, 0, 0, 0], + vec![0, 0, 0, 1], + vec![0, 0, 1, 0], + ]), + 0 + ); + } +} diff --git a/src/problem/p0064_minimum_path_sum.rs b/src/problem/p0064_minimum_path_sum.rs new file mode 100644 index 00000000..e29be255 --- /dev/null +++ b/src/problem/p0064_minimum_path_sum.rs @@ -0,0 +1,72 @@ +/** + * [64] Minimum Path Sum + * + * Given a m x n grid filled with non-negative numbers, find a path from top left to bottom right, which minimizes the sum of all numbers along its path. + * Note: You can only move either down or right at any point in time. + * + * Example 1: + * + * Input: grid = [[1,3,1],[1,5,1],[4,2,1]] + * Output: 7 + * Explanation: Because the path 1 → 3 → 1 → 1 → 1 minimizes the sum. + * + * Example 2: + * + * Input: grid = [[1,2,3],[4,5,6]] + * Output: 12 + * + * + * Constraints: + * + * m == grid.length + * n == grid[i].length + * 1 <= m, n <= 200 + * 0 <= grid[i][j] <= 100 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/minimum-path-sum/ +// discuss: https://leetcode.com/problems/minimum-path-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn min_path_sum(grid: Vec>) -> i32 { + let depth = grid.len(); + let width = grid[0].len(); + let mut sum = grid.clone(); + + for i in 0..depth { + for j in 0..width { + if 0 < i && 0 < j{ + sum[i][j] = std::cmp::min(sum[i-1][j], sum[i][j-1]) + grid[i][j]; + } else if 0 < i { + sum[i][j] = sum[i-1][j] + grid[i][j]; + } else if 0 < j { + sum[i][j] = sum[i][j-1] + grid[i][j]; + } else { + sum[i][j] = grid[i][j]; + } + } + } + sum[depth-1][width-1] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_64() { + assert_eq!(Solution::min_path_sum(vec![vec![2]]), 2); + assert_eq!( + Solution::min_path_sum(vec![vec![1, 3, 1], vec![1, 5, 1], vec![4, 2, 1],]), + 7 + ); + assert_eq!(Solution::min_path_sum(vec![vec![1, 3, 1],]), 5); + } +} diff --git a/src/problem/p0065_valid_number.rs b/src/problem/p0065_valid_number.rs new file mode 100644 index 00000000..d5e76c41 --- /dev/null +++ b/src/problem/p0065_valid_number.rs @@ -0,0 +1,158 @@ +/** + * [65] Valid Number + * + * A valid number can be split up into these components (in order): + *
    + * A decimal number or an integer. + * (Optional) An 'e' or 'E', followed by an integer. + *
+ * A decimal number can be split up into these components (in order): + *
    + * (Optional) A sign character (either '+' or '-'). + * One of the following formats: + *
      + * At least one digit, followed by a dot '.'. + * At least one digit, followed by a dot '.', followed by at least one digit. + * A dot '.', followed by at least one digit. + *
    + * + *
+ * An integer can be split up into these components (in order): + *
    + * (Optional) A sign character (either '+' or '-'). + * At least one digit. + *
+ * For example, all the following are valid numbers: ["2", "0089", "-0.1", "+3.14", "4.", "-.9", "2e10", "-90E3", "3e+7", "+6e-1", "53.5e93", "-123.456e789"], while the following are not valid numbers: ["abc", "1a", "1e", "e3", "99e2.5", "--6", "-+3", "95a54e53"]. + * Given a string s, return true if s is a valid number. + * + * Example 1: + * + * Input: s = "0" + * Output: true + * + * Example 2: + * + * Input: s = "e" + * Output: false + * + * Example 3: + * + * Input: s = "." + * Output: false + * + * Example 4: + * + * Input: s = ".1" + * Output: true + * + * + * Constraints: + * + * 1 <= s.length <= 20 + * s consists of only English letters (both uppercase and lowercase), digits (0-9), plus '+', minus '-', or dot '.'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/valid-number/ +// discuss: https://leetcode.com/problems/valid-number/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn is_integer(s : &String, min_numeric_len: usize, sign_optional : bool) -> bool { + if s.len() == 0 { + return min_numeric_len == 0; + } + + let mut s : Vec = s.chars().collect(); + if sign_optional && (s[0] == '+' || s[0] == '-') { + s = s.iter().skip(1).cloned().collect(); + } + + let mut valid : bool = s.len() >= min_numeric_len; + for &c in s.iter() { + if !c.is_ascii_digit() { + valid = false; + break; + } + } + valid + } + + pub fn is_decimal(s : &String) -> bool { + let s : Vec = s.chars().collect(); + if let Some(dot_pos) = s.iter().position(|c : &char|{*c=='.'}) { + let first_part : String = s.iter().take(dot_pos).collect(); + let sec_part : String = s.iter().skip(dot_pos + 1).collect(); + println!("\tfirst_part_decimal = [{}], sec_part_decimal = [{}]", first_part, sec_part); + let ge1_char_first = Self::is_integer(&first_part, 1, true); + let ge0_char_sec = Self::is_integer(&sec_part, 0, false); + + let ge0_char_first = Self::is_integer(&first_part, 0, true); + let ge1_char_sec = Self::is_integer(&sec_part, 1, false); + println!("ge1_char_first={}, ge0_char_sec={}",ge1_char_first, ge0_char_sec); + println!("ge0_char_first={}, ge1_char_sec={}",ge0_char_first, ge1_char_sec); + (ge1_char_first && ge0_char_sec) || (ge0_char_first && ge1_char_sec) + } else { + false + } + } + + pub fn is_number(s: String) -> bool { + let s : Vec = s.chars().collect(); + if let Some(e_pos) = s.iter().position(|c : &char|{*c=='E' || *c =='e'}) { + let first_part : String = s.iter().take(e_pos).collect(); + let sec_part : String = s.iter().skip(e_pos + 1).collect(); + println!("first_part = {}, sec_part = {}", first_part, sec_part); + + let mut valid_first : bool = false; + let mut valid_sec : bool = false; + + if Self::is_decimal(&first_part) { + println!("first part is decimal"); + valid_first = true; + } + + if !valid_first && Self::is_integer(&first_part, 1, true) { + println!("first part is int."); + valid_first = true; + } + + if Self::is_integer(&sec_part, 1, true) { + println!("sec part is int."); + valid_sec = true; + } + valid_first && valid_sec + } else { + let s : String = s.iter().collect(); + let mut valid_whole : bool = false; + if Self::is_decimal(&s) { + println!("The whole is decimal"); + valid_whole = true; + } + + if !valid_whole && Self::is_integer(&s, 1, true) { + println!("The whole is int."); + valid_whole = true; + } + valid_whole + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_65() { + assert!(Solution::is_number("0".to_owned())); + assert!(!Solution::is_number("e".to_owned())); + assert!(!Solution::is_number(".".to_owned())); + assert!(Solution::is_number(".1".to_owned())); + assert!(Solution::is_number("2e0".to_owned())); + } +} diff --git a/src/problem/p0068_text_justification.rs b/src/problem/p0068_text_justification.rs new file mode 100644 index 00000000..566f6339 --- /dev/null +++ b/src/problem/p0068_text_justification.rs @@ -0,0 +1,192 @@ +/** + * [68] Text Justification + * + * Given an array of words and a width maxWidth, format the text such that each line has exactly maxWidth characters and is fully (left and right) justified. + * You should pack your words in a greedy approach; that is, pack as many words as you can in each line. Pad extra spaces ' ' when necessary so that each line has exactly maxWidth characters. + * Extra spaces between words should be distributed as evenly as possible. If the number of spaces on a line do not divide evenly between words, the empty slots on the left will be assigned more spaces than the slots on the right. + * For the last line of text, it should be left justified and no extra space is inserted between words. + * Note: + * + * A word is defined as a character sequence consisting of non-space characters only. + * Each word's length is guaranteed to be greater than 0 and not exceed maxWidth. + * The input array words contains at least one word. + * + * + * Example 1: + * + * Input: words = ["This", "is", "an", "example", "of", "text", "justification."], maxWidth = 16 + * Output: + * [ + * "This is an", + * "example of text", + * "justification. " + * ] + * Example 2: + * + * Input: words = ["What","must","be","acknowledgment","shall","be"], maxWidth = 16 + * Output: + * [ + * "What must be", + * "acknowledgment ", + * "shall be " + * ] + * Explanation: Note that the last line is "shall be " instead of "shall be", because the last line must be left-justified instead of fully-justified. + * Note that the second line is also left-justified becase it contains only one word. + * Example 3: + * + * Input: words = ["Science","is","what","we","understand","well","enough","to","explain","to","a","computer.","Art","is","everything","else","we","do"], maxWidth = 20 + * Output: + * [ + * "Science is what we", + * "understand well", + * "enough to explain to", + * "a computer. Art is", + * "everything else we", + * "do " + * ] + * + * Constraints: + * + * 1 <= words.length <= 300 + * 1 <= words[i].length <= 20 + * words[i] consists of only English letters and symbols. + * 1 <= maxWidth <= 100 + * words[i].length <= maxWidth + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/text-justification/ +// discuss: https://leetcode.com/problems/text-justification/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn left(this_line : &Vec, max_width : usize) -> String { + let mut r : String = this_line[0].clone(); + for i in 1..this_line.len() { + r.push(' '); + r.push_str(&this_line[i]); + } + + while r.len() < max_width { + r.push(' '); + } + r + } + + pub fn full(this_line : &Vec, max_width : usize) -> String { + let char_count : usize = this_line.iter().map(|x|{x.len()}).sum(); + let space_count : usize = max_width - char_count; + let slot_count : usize = this_line.len() - 1; + + let space_per_slot : usize = space_count / slot_count; + let mut spaces : Vec = vec![space_per_slot; slot_count]; + + for i in 0..(space_count % slot_count) { + spaces[i] +=1; + } + // println!("this_line = {:?}, char_count={}, spaces={:?}", this_line, char_count, spaces) ; + let mut r : String = this_line[0].clone(); + for i in 0..slot_count { + r.push_str(&(0..spaces[i]).map(|i|{' '}).collect::()); + r.push_str(&this_line[i+1].clone()); + } + r + } + + pub fn full_justify(words: Vec, max_width: i32) -> Vec { + let max_width = max_width as usize; + let mut this_line : Vec = vec![words[0].clone()]; + let mut i : usize = 1; + let n : usize = words.len(); + let mut lines = vec![]; + + loop { + while i < n && this_line.iter().map(|w|{w.len()+1}).sum::() + words[i].len() <= max_width { + this_line.push(words[i].clone()); + i+=1; + } + if i == n { + lines.push(Self::left(&this_line, max_width)); + break; + } else if this_line.len() == 1 { + lines.push(Self::left(&this_line, max_width)); + } else { + lines.push(Self::full(&this_line, max_width)); + } + this_line = vec![words[i].clone()]; + i += 1; + } + + lines + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_68() { + assert_eq!( + Solution::full_justify( + vec_string![ + "This", + "is", + "an", + "example", + "of", + "text", + "justification." + ], + 16 + ), + vec_string!["This is an", "example of text", "justification. "] + ); + + assert_eq!( + Solution::full_justify( + vec_string!["What", "must", "be", "acknowledgment", "shall", "be"], + 16 + ), + vec_string!["What must be", "acknowledgment ", "shall be "] + ); + + assert_eq!( + Solution::full_justify( + vec_string![ + "Science", + "is", + "what", + "we", + "understand", + "well", + "enough", + "to", + "explain", + "to", + "a", + "computer.", + "Art", + "is", + "everything", + "else", + "we", + "do" + ], + 20 + ), + vec_string![ + "Science is what we", + "understand well", + "enough to explain to", + "a computer. Art is", + "everything else we", + "do ", + ] + ); + } +} diff --git a/src/problem/p0071_simplify_path.rs b/src/problem/p0071_simplify_path.rs new file mode 100644 index 00000000..f45c4673 --- /dev/null +++ b/src/problem/p0071_simplify_path.rs @@ -0,0 +1,125 @@ +/** + * [71] Simplify Path + * + * Given a string path, which is an absolute path (starting with a slash '/') to a file or directory in a Unix-style file system, convert it to the simplified canonical path. + * In a Unix-style file system, a period '.' refers to the current directory, a double period '..' refers to the directory up a level, and any multiple consecutive slashes (i.e. '//') are treated as a single slash '/'. For this problem, any other format of periods such as '...' are treated as file/directory names. + * The canonical path should have the following format: + * + * The path starts with a single slash '/'. + * Any two directories are separated by a single slash '/'. + * The path does not end with a trailing '/'. + * The path only contains the directories on the path from the root directory to the target file or directory (i.e., no period '.' or double period '..') + * + * Return the simplified canonical path. + * + * Example 1: + * + * Input: path = "/home/" + * Output: "/home" + * Explanation: Note that there is no trailing slash after the last directory name. + * + * Example 2: + * + * Input: path = "/../" + * Output: "/" + * Explanation: Going one level up from the root directory is a no-op, as the root level is the highest level you can go. + * + * Example 3: + * + * Input: path = "/home//foo/" + * Output: "/home/foo" + * Explanation: In the canonical path, multiple consecutive slashes are replaced by a single one. + * + * Example 4: + * + * Input: path = "/a/./b/../../c/" + * Output: "/c" + * + * + * Constraints: + * + * 1 <= path.length <= 3000 + * path consists of English letters, digits, period '.', slash '/' or '_'. + * path is a valid absolute Unix path. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/simplify-path/ +// discuss: https://leetcode.com/problems/simplify-path/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn simplify_path(path: String) -> String { + // Separate into words by / or consecutive // + let mut words = vec![]; + + let mut word_start = 0; // inclusive + let mut word_end = word_start + 1; // exclusive + + loop { + while let Some(cur_char) = path.chars().nth(word_start) { + if cur_char != '/' { + break + } + word_start+=1; + } + if word_start == path.len() { + break + } + + word_end = word_start+1; + while let Some(cur_char) = path.chars().nth(word_end) { + if cur_char == '/' { + break + } + word_end+=1; + } + + let word : String = path.chars().skip(word_start).take(word_end-word_start).collect(); + words.push(word); + word_start = word_end; + word_end = word_start+1; + } + + let mut result_words = vec![]; + + for word in words { + if word == ".." { + result_words.pop(); + } else if word == "." { + continue; + } else { + result_words.push(word); + } + } + let mut result = String::from("/"); + result.push_str(result_words.join("/").as_str()); + result + // Concat str with "/word" + // String::new() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_71() { + assert_eq!(Solution::simplify_path("/home/".to_owned()), "/home"); + assert_eq!(Solution::simplify_path("/../".to_owned()), "/"); + assert_eq!(Solution::simplify_path("/a/./b/../../c/".to_owned()), "/c"); + assert_eq!( + Solution::simplify_path("/a/../../b/../c//.//".to_owned()), + "/c" + ); + assert_eq!( + Solution::simplify_path("/a//b////c/d//././/..".to_owned()), + "/a/b/c" + ); + } +} diff --git a/src/problem/p0072_edit_distance.rs b/src/problem/p0072_edit_distance.rs new file mode 100644 index 00000000..545e0c73 --- /dev/null +++ b/src/problem/p0072_edit_distance.rs @@ -0,0 +1,85 @@ +/** + * [72] Edit Distance + * + * Given two strings word1 and word2, return the minimum number of operations required to convert word1 to word2. + * You have the following three operations permitted on a word: + * + * Insert a character + * Delete a character + * Replace a character + * + * + * Example 1: + * + * Input: word1 = "horse", word2 = "ros" + * Output: 3 + * Explanation: + * horse -> rorse (replace 'h' with 'r') + * rorse -> rose (remove 'r') + * rose -> ros (remove 'e') + * + * Example 2: + * + * Input: word1 = "intention", word2 = "execution" + * Output: 5 + * Explanation: + * intention -> inention (remove 't') + * inention -> enention (replace 'i' with 'e') + * enention -> exention (replace 'n' with 'x') + * exention -> exection (replace 'n' with 'c') + * exection -> execution (insert 'u') + * + * + * Constraints: + * + * 0 <= word1.length, word2.length <= 500 + * word1 and word2 consist of lowercase English letters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/edit-distance/ +// discuss: https://leetcode.com/problems/edit-distance/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn min_distance(word1: String, word2: String) -> i32 { + let word1 : Vec = word1.chars().collect(); + let word2 : Vec = word2.chars().collect(); + let mut result = vec![vec![0;word2.len()+1];word1.len()+1]; + for i in 0..=word1.len() { + result[i][0] = i; + } + + for j in 0..=word2.len() { + result[0][j] = j; + } + + for i in 1..=word1.len() { + for j in 1..=word2.len() { + result[i][j] = result[i-1][j] + 1; + result[i][j] = std::cmp::min(result[i][j], result[i][j-1] + 1); + if word1[i-1] == word2[j-1] { + result[i][j] = std::cmp::min(result[i][j], result[i-1][j-1]); + } else { + result[i][j] = std::cmp::min(result[i][j], result[i-1][j-1]+1); + } + } + } + result[word1.len()][word2.len()] as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_72() { + assert_eq!(Solution::min_distance("horse".to_owned(), "ros".to_owned()),3); + assert_eq!(Solution::min_distance("intention".to_owned(), "execution".to_owned()),5); + } +} diff --git a/src/problem/p0073_set_matrix_zeroes.rs b/src/problem/p0073_set_matrix_zeroes.rs new file mode 100644 index 00000000..f5a4e07f --- /dev/null +++ b/src/problem/p0073_set_matrix_zeroes.rs @@ -0,0 +1,99 @@ +/** + * [73] Set Matrix Zeroes + * + * Given an m x n matrix. If an element is 0, set its entire row and column to 0. Do it in-place. + * Follow up: + * + * A straight forward solution using O(mn) space is probably a bad idea. + * A simple improvement uses O(m + n) space, but still not the best solution. + * Could you devise a constant space solution? + * + * + * Example 1: + * + * Input: matrix = [[1,1,1],[1,0,1],[1,1,1]] + * Output: [[1,0,1],[0,0,0],[1,0,1]] + * + * Example 2: + * + * Input: matrix = [[0,1,2,0],[3,4,5,2],[1,3,1,5]] + * Output: [[0,0,0,0],[0,4,5,0],[0,3,1,0]] + * + * + * Constraints: + * + * m == matrix.length + * n == matrix[0].length + * 1 <= m, n <= 200 + * -2^31 <= matrix[i][j] <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/set-matrix-zeroes/ +// discuss: https://leetcode.com/problems/set-matrix-zeroes/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn set_zeroes(matrix: &mut Vec>) { + let row_count : usize = matrix.len(); + let col_count : usize = matrix[0].len(); + + let mut first_row_zero : bool = false; + for j in 0..col_count { + if matrix[0][j] == 0 { + first_row_zero = true; + break; + } + } + + let mut first_col_zero : bool = false; + for i in 0..row_count { + if matrix[i][0] == 0 { + first_col_zero = true; + break; + } + } + + for i in 1..row_count { + for j in 1..col_count { + if matrix[i][j] == 0 { + matrix[0][j] = 0; + matrix[i][0] = 0; + } + } + } + + for i in 1..row_count { + for j in 1..col_count { + if matrix[i][0] == 0 || matrix[0][j] == 0 { + matrix[i][j] = 0; + } + } + } + + if first_row_zero { + for j in 0..col_count { + matrix[0][j] = 0; + } + } + + if first_col_zero { + for i in 0..row_count { + matrix[i][0] = 0; + } + } + + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_73() {} +} diff --git a/src/problem/p0074_search_a_2d_matrix.rs b/src/problem/p0074_search_a_2d_matrix.rs new file mode 100644 index 00000000..33145c91 --- /dev/null +++ b/src/problem/p0074_search_a_2d_matrix.rs @@ -0,0 +1,76 @@ +/** + * [74] Search a 2D Matrix + * + * Write an efficient algorithm that searches for a value in an m x n matrix. This matrix has the following properties: + * + * Integers in each row are sorted from left to right. + * The first integer of each row is greater than the last integer of the previous row. + * + * + * Example 1: + * + * Input: matrix = [[1,3,5,7],[10,11,16,20],[23,30,34,60]], target = 3 + * Output: true + * + * Example 2: + * + * Input: matrix = [[1,3,5,7],[10,11,16,20],[23,30,34,60]], target = 13 + * Output: false + * + * + * Constraints: + * + * m == matrix.length + * n == matrix[i].length + * 1 <= m, n <= 100 + * -10^4 <= matrix[i][j], target <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/search-a-2d-matrix/ +// discuss: https://leetcode.com/problems/search-a-2d-matrix/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn get(matrix: &Vec>, idx: usize) -> i32 { + let col_count = matrix[0].len(); + let row_idx = idx / col_count; + let col_idx = idx % col_count; + matrix[row_idx as usize][col_idx as usize] + } + + pub fn search_matrix(matrix: Vec>, target: i32) -> bool { + let count = matrix.len() * matrix[0].len(); + let mut start = 0; // inclusive + let mut end = count as usize; // exclusive + + while start < end { + let mid = (start + end) / 2; + let mid_num = Self::get(&matrix, mid as usize); + if mid_num == target { + return true; + // } else if start == end - 1 { + // return false; + } else if mid_num < target { + start = mid+1; + } else { + end = mid; + } + } + + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_74() { + } +} diff --git a/src/problem/p0075_sort_colors.rs b/src/problem/p0075_sort_colors.rs new file mode 100644 index 00000000..a3e8f36e --- /dev/null +++ b/src/problem/p0075_sort_colors.rs @@ -0,0 +1,137 @@ +/** + * [75] Sort Colors + * + * Given an array nums with n objects colored red, white, or blue, sort them in-place so that objects of the same color are adjacent, with the colors in the order red, white, and blue. + * We will use the integers 0, 1, and 2 to represent the color red, white, and blue, respectively. + * + * Example 1: + * Input: nums = [2,0,2,1,1,0] + * Output: [0,0,1,1,2,2] + * Example 2: + * Input: nums = [2,0,1] + * Output: [0,1,2] + * Example 3: + * Input: nums = [0] + * Output: [0] + * Example 4: + * Input: nums = [1] + * Output: [1] + * + * Constraints: + * + * n == nums.length + * 1 <= n <= 300 + * nums[i] is 0, 1, or 2. + * + * + * Follow up: + * + * Could you solve this problem without using the library's sort function? + * Could you come up with a one-pass algorithm using only O(1) constant space? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/sort-colors/ +// discuss: https://leetcode.com/problems/sort-colors/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn sort_colors(nums: &mut Vec) { + if nums.len() == 0 {return;} + let mut zero_end : i32 = 0; // exclusive + let mut two_start : i32 = nums.len() as i32 - 1; // exclusive + let mut i : i32 = 0; + // invariant before iterations: + // all zeros in [0, zero_end) + // all ones in [zero_end, i) + // all twos in (two_start, END) + while i <= two_start { + let num : i32 = nums[i as usize]; + if num == 0 { + nums.swap(zero_end as usize, i as usize); + i+=1; + zero_end+=1; + } else if num == 1 { + i+=1; + } else if num == 2 { + nums.swap(two_start as usize, i as usize); + two_start -=1; + } + } + } + + pub fn sort_colors_2(nums: &mut Vec) { + let (mut zero_start, mut one_start, mut two_start) = (nums.len(), nums.len(), nums.len()); + while 0 < zero_start { + println!("==================================="); + println!("From: {:?}", nums); + println!("zero: {}, one: {}, two: {}", zero_start, one_start, two_start); + + match(nums[0]) { + 0 =>{ + zero_start-=1; + nums.swap(0, zero_start); + }, + 1 => { + zero_start-=1; + one_start-=1; + nums.swap(zero_start, one_start); + if 0 < zero_start { + // still got unprocessed num. + // move it to start for next-round processing + nums.swap(0, one_start); + } + + }, + 2 => { + two_start-=1; + zero_start-=1; + one_start-=1; + nums.swap(zero_start, one_start); + nums.swap(one_start, two_start); + if 0 < zero_start { + nums.swap(0, two_start); + } + }, + _ => { + panic!("error"); + } + }; + println!("To: {:?}", nums); + println!("===================================\n"); + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_75() { + let mut vec = vec![ + 1, 2, 0, 1, 2, 2, 2, 0, 0, 0, 2, 1, 1, 2, 0, 1, 2, 2, 1, 1, 0, + ]; + Solution::sort_colors(&mut vec); + assert_eq!( + vec, + vec![0, 0, 0, 0, 0, 0, 1, 1, 1, 1, 1, 1, 1, 2, 2, 2, 2, 2, 2, 2, 2] + ); + + // let mut vec = vec![]; + // Solution::sort_colors(&mut vec); + // assert_eq!(vec, vec![]); + + let mut vec = vec![2, 2, 2]; + Solution::sort_colors(&mut vec); + assert_eq!(vec, vec![2, 2, 2]); + + let mut vec = vec![2,0,2,1,1,0]; + Solution::sort_colors(&mut vec); + assert_eq!(vec, vec![0,0,1,1,2,2]); + } +} diff --git a/src/problem/p0076_minimum_window_substring.rs b/src/problem/p0076_minimum_window_substring.rs new file mode 100644 index 00000000..244d8666 --- /dev/null +++ b/src/problem/p0076_minimum_window_substring.rs @@ -0,0 +1,143 @@ +/** + * [76] Minimum Window Substring + * + * Given two strings s and t, return the minimum window in s which will contain all the characters in t. If there is no such window in s that covers all characters in t, return the empty string "". + * Note that If there is such a window, it is guaranteed that there will always be only one unique minimum window in s. + * + * Example 1: + * Input: s = "ADOBECODEBANC", t = "ABC" + * Output: "BANC" + * Example 2: + * Input: s = "a", t = "a" + * Output: "a" + * + * Constraints: + * + * 1 <= s.length, t.length <= 10^5 + * s and t consist of English letters. + * + * + * Follow up: Could you find an algorithm that runs in O(n) time? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/minimum-window-substring/ +// discuss: https://leetcode.com/problems/minimum-window-substring/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +// use std::{collections::HashMap, hash::Hash}; +use std::collections::HashMap; +impl Solution { + pub fn min_window(s: String, t: String) -> String { + let mut needed_count : HashMap = HashMap::new(); + for c in t.chars() { + *needed_count.entry(c).or_insert(0i32)+=1; + } + + let mut start : usize = 0; // inclusive + let mut end : usize = 0; // exclusive + let len : usize = s.len(); + let s : Vec = s.chars().collect(); + + let mut min_len : usize = 100001; + let mut min_start : usize = 0; + while end < len { + while end < len && needed_count.iter().any(|(_, &c)|{c>0}) { + let new_char : char = s[end]; + if let Some(count) = needed_count.get_mut(&new_char) { + *count-=1; + } + end += 1; + } + + while start < len && needed_count.iter().all(|(_, &c)|{c<=0}) { + let sub_len : usize = end - start; + if sub_len < min_len { + min_start = start; + min_len = sub_len; + } + + let removed_char : char = s[start]; + if let Some(count) = needed_count.get_mut(&removed_char) { + *count+=1; + } + start += 1; + } + } + + if min_len == 100001 { + "".to_owned() + } else { + let min_end : usize = min_start + min_len; // exclusive + // println!("s.len()={},min_start={},min_end={}",s.len(), min_start, min_end); + s[min_start..min_end].iter().collect() + // s.iter().enumerate().filter(|&(i,v)|{i>=min_start && i <= min_end}).map(|(_,&v)|{v}).collect() + } + } + + pub fn my_min_window(s: String, t: String) -> String { + // needed_char_count[i] is positive implies we need char i. + let mut needed_char_count = vec![0;128]; + let mut contained_char_count = 0; // # of chars in T contained in the subs + for c in t.chars() { + needed_char_count[c as usize] += 1; + } + + let mut start = 0usize; // inclusive + let mut end = 0usize; // inclusive + let n = s.len(); + let mut min_start = 0usize; + let mut min_len = 100000001usize; + + // reference a n-th char in a string require for linear complexity. + // transform to a char vector to avoid this issue. + let ss: Vec = s.chars().collect(); + while end < n { + let end_char = ss[end] as usize; + if needed_char_count[end_char] > 0 {contained_char_count+=1;} + needed_char_count[end_char]-=1; + + end+=1; + // println!("start={}, end={}", start, end); + while contained_char_count == t.len() { + if (end-start) < min_len { + min_start = start; + min_len = end -start; + } + + let start_char = ss[start as usize] as usize; + needed_char_count[start_char]+=1; + if needed_char_count[start_char] > 0 {contained_char_count-=1;} + + start+=1; + } + + } + if min_len <= s.len() { + s.as_str()[min_start..min_start+min_len].to_owned() + } else { + "".to_owned() + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_76() { + // assert_eq!(Solution::min_window("ADOBECODEBANC".to_owned(), "ABC".to_owned()), "BANC"); + // assert_eq!(Solution::min_window("a".to_owned(), "a".to_owned()), "a"); + // assert_eq!(Solution::min_window("a".to_owned(), "aa".to_owned()), ""); + + + let s = "kgfidhktkjhlkbgjkylgdracfzjduycghkomrbfbkoowqwgaurizliesjnveoxmvjdjaepdqftmvsuyoogobrutahogxnvuxyezevfuaaiyufwjtezuxtpycfgasburzytdvazwakuxpsiiyhewctwgycgsgdkhdfnzfmvhwrellmvjvzfzsdgqgolorxvxciwjxtqvmxhxlcijeqiytqrzfcpyzlvbvrksmcoybxxpbgyfwgepzvrezgcytabptnjgpxgtweiykgfiolxniqthzwfswihpvtxlseepkopwuueiidyquratphnnqxflqcyiiezssoomlsxtyxlsolngtctjzywrbvajbzeuqsiblhwlehfvtubmwuxyvvpwsrhutlojgwktegekpjfidgwzdvxyrpwjgfdzttizquswcwgshockuzlzulznavzgdegwyovqlpmnluhsikeflpghagvcbujeapcyfxosmcizzpthbzompvurbrwenflnwnmdncwbfebevwnzwclnzhgcycglhtbfjnjwrfxwlacixqhvuvivcoxdrfqazrgigrgywdwjgztfrbanwiiayhdrmuunlcxstdsrjoapntugwutuedvemyyzusogumanpueyigpybjeyfasjfpqsqotkgjqaxspnmvnxbfvcobcudxflmvfcjanrjfthaiwofllgqglhkndpmiazgfdrfsjracyanwqsjcbakmjubmmowmpeuuwznfspjsryohtyjuawglsjxezvroallymafhpozgpqpiqzcsxkdptcutxnjzawxmwctltvtiljsbkuthgwwbyswxfgzfewubbpowkigvtywdupmankbndyligkqkiknjzchkmnfflekfvyhlijynjlwrxodgyrrxvzjhoroavahsapdiacwjpucnifviyohtprceksefunzucdfchbnwxplhxgpvxwrmpvqzowgimgdolirslgqkycrvkgshejuuhmvvlcdxkinvqgpdnhnljeiwmadtmzntokqzmtyycltuukahsnuducziedbscqlsbbtpxrobfhxzuximncrjgrrkwvdalqtoumergsulbrmvrwjeydpguiqqdvsrmlfgylzedtrhkfebbohbrwhnhxfmvxdhjlpjwopchgjtnnvodepwdylkxqwsqczznqklezplhafuqcitizslzdvwwupmwqnlhxwlwozdogxekhasisehxbdtvuhrlucurbhppgsdoriyykricxpbyvxupencbqwsreiimclbuvbufudjrslsnkofobhptgkmmuuywizqddllxowpijhytvdkymzsulegfzfcjguojhzhxyyghhgbcllazmuuyzafahjjqgxznzinxgvgnbhrmuuljohjpkqpraahgajvzriyydengofskzgtppefzvwrvxadxjaydjydocqvsxpdyxyondvmyrfvqiaptanwllbaquxirmlqkmgzpbnputmldmcwoqvadwavqxeilraxdiwulmlffxsilvgcnbcsyeoqdsaolcorkmlxyzfdyznkuwmjxqcxusoxmqlxtzofocdmbiqzhflebzpbprajjqivhuvcvlhjnkwquosevfkzfzcwtcietqcamxcikltawrsshkydsiexkgvdidjbuldgkfqvrkxpdpjlakqsuurecmjkstomgrutzlqsxnjacuneedyzzrfbgpoykcmsvglwtdoqqztvugzakazlrhnxwdxifjccsozlrpckpxfldglpgnbauqzstxcaiecaudmotqyknfvsliiuvlurbvjwulwdsadmerazjyjydgrrobnmmjdpeplzcjcujhhpbhqmizlnhcgwftkrcnghctifcmbnvifwsvjcxwpeyycdrmwucedexnlbznquxvtpretoaluajxfajdwnhbugofjpuzmuxflolfenqynzxubjxawgbqmsyvhuwvotaajnfpaxqnwnjzwgzvmdnaxlxeiucwpcyzqfoqcegaspcqybnmgbndomkwgmvyqvxgblzfshimykeynslutaxjmjgvvdtmysubfvjxcrjddobsgombomkdvsatvvfwnzxsvgszzbccrgxzulclzpqvhsqfnvbcwywrfotgsxlldilatnntcfqmxgrkdsozsktzbogtlrerzrtuhiplnfxknqwsikudwncxdiqozxhaoavximjvuihjzdcjpwmmlploxeezbmzrmwrxlauficojhqtxohlzwwpwcuvfgwzuvqrgqmlaozmxshuiohingzjitgobcnwzdpfvdsxrujroqlwhvgubgdlzjzdnozptqwqurqnlzezssvznctokybljdoyrppngmdcdvpqvuppmmqbqlrajsmuvcupskcawhcbdrrangrbuhcnstndobzjgtyydcabkccpvtpjbgmyprljkamaelkkgkkmnknzosojnfupnhncyalkazlemxoshaewkuvymjkzqeqdlfflfsygrjmdidypdcmoyjoktykldapqiwenpcviniovnmkqqygpivbdvloaoftwcxltzhbmrrhedtuuudleamjvaxwqfrohozcpidbzxkfafcwbfjffwocyoaotrccfdeumjxngjthrvfsapyhnojlcmbxddzlidhwnhktqdcjykcazcjoqszveaskfsvnxckkjwgczknzupbvtkjmeihlkzvptqfrurdgnjkouxpqpqmicvugebrqdmgyenpbethrerhaqwrfodoqaiyemqxredpjqhkwctpgmwjcsaiifyyfiwmuojntmdeemqaolpwxnfbffjpmjnssleocncxbhbhttjjeyfdllessqjfzwxtjdilsmivvlcqglzmlepyrwskmbrnzqhivrwnfgiasmsaxrnkxeipaaboduccklmfckuhrcjlqblnuaxrfhihjlwofyqrleynpswiwhvmigbejavojgvsrtgztysefrrulpekwzwghakqaigkocehxnirlbvqspmfgqpdrolzowrqgycuchdzumqhnmyhdmojfeowsaxiypyenbapidoerhletlnyychdgwbayziwoicbjcsthixzplfkwtiwvsbdodfocpksxmvhqnczvaylnexjxgguyhzomecotoiqcdzuqctoesbrwyavgiresquewyvrmdhqhjkzleppwqgupirxtkcncytyxqpjuyadhmeuqulomtidcbbxlfmndfnawcmsdoxkadhtzshmmsrotsnfxzudgifcmtwpjtamzhfybmkneedawqhwrbzyjgawaznjunvtwcsypenvirvhhcdbgezrkbnmadyvsvopyippnckxviedmjgsnfkaizmjckgviwmghdvwhhtdpaicjowxvgzdglokyufgtroawjwesrhirrmbfiacrzfzmujmqpujiilftjlmdswulkxquzslyzkltuzmluxtcjawulkxfguqqrikrcwreiezeelpyjlaulyqziogqizgbhtsmrmqzqreudvsogviuvyveobuyadakwuwngomxfsrkomywhiqejlixnfwpiwzesxrznfwvapfobekkmdpxqzvdettopusjsliftgatwijzmvmaydypcvujopxfksocfxjydmrbuabiwpkwsklwfihtxhahzpleoxftjwvfzynxnzthkhfppnloulyvajbqigktdhyefnbunwdxfiowxzltljonuqgfwqybxzhemkybjdyolnnjmaczjtpfjvmhlllkkuoyhoaqrageptnetsdelumwpyfclsoxpewwsymlasqqofuhzxomucijaqookclzhjxbhjniefaukudkrrwlthxwznklpvnyfkaowpyauyugsxsmrrzmayiblsmdqzdxmfniuoiqoezjdtvukwhmxrnkkcncbtzpyoxvchnrlmarixnuvwhsowfayuccndrmrpjuwwnklnbtmqnhnwcbthbrbfvpkndbemxaikmvzpqlgettcxwvezpfgmwqzzrfnriybutdmkosqjnsglqkkhsqtogvqzadsibudvzphnjxxyrfjhsvokniyvdowfupovlrskizxtwwroecxwzmgmwghbxdgruumfnfpxensdlltpnqloeraayjdxpmojiapwhgvotorhbmypckdjdgjdrpagbosjrhhyndojthsutqlwcrfizqlqhozieruvabwpgmabusynljlncsvbljusztddkxbkyzbhlcifugthsexuxsykdsccnfixcljdkkkvmudjbwstcppbkplnhqsuvctanedxppudjxomvhhywzbgonwydquasoahsfejuangybsvkctjbxppknnpfirxyugszmcwnpcnswifycobbfrltgcaovaopghptjngartunbzofppgvitqpxqftquixbzqmmwmdrituijaxaiujckabbfwrbfqeggqveeaxntsxcuwfcrqgbqiexgybnofuxypdepbrltqpnnurgkyjcioaoobcciybgnflegerzvhokdfqofzsnpsedvgieejmtoxzuervzajldrbtwcmmsgqvcyfiepuzduayyrvztfkxylquneihlyfpykxczrddledlxykrfwofjgcznkgyllnjwkovdrarxfcvepmllatvivuvfcvsoickushylirjntetkqhwsatcvpyctvvheztardaenrncnrwxjfvbhqechegbzdifcegvhiauapwnhukqbiuiyamgethfwrnbvvyedyadozsxvfpxnlhllutrpaxnumorhnyknyqdziavpsucdbqpxjimmhaitqzadxltybwxlzsbrofwqxlnjwcvdcfxsexyektcnpbbqucjkjgahtqqpsntwssoyrocchgrzispewzoghrpajfqbulxmdnmuerylxqmhkenhfcpmvemelehfretwtftxwrlwjxfwdtdivuwsalwlpdsjjlfcqyapsnnbmsxqlcaiyxayiylzbdimoophorygelkqdhirmjzmgcloaynecyqsofbcyzjemtvscfjqokdumqknoarsyjnoroqpqbucwrwbwhtlswhgouvfuoxuykipbagreavatudqbxdvvmekgzpaqowobgfchlvlosnhotxsqcnnptxvtowlduzebgiirfvfzkpofmgxpvlgpibkxzvcuwivcqfvxcbwoqkueqrvmcbdnfnmeioaewxiocdlgehvwurdkkyypcdchqonaeoealmqqqbwwktvemyrxyrocvqlngzokpsmahcszfrvrmsyzsryrkmvfehvkgjwxdixkmsjtjhmvbkwubwnmiitopoaxxwudgunumznxiasjmrfqnscybxmsonqnlmquigowfetpeoasfgiuymsbmhuawmphagbjmsftwbkcpkuusdqrrjudqqdmetvfbzqprvkpwurnenjxsaqkjmnbdtphomorlegecqtammoqazpuzhekuunzpcidpxwcdcjhueigryytxqnzzujtqxufbdkscgxfkgpgkxmdxmwwemxegjzwgudjxncbvzifhxlrwzvtntssfpwnyxlgrosqduryvadcxqvupspdmjxtbvhbssimjacowwntysvvjsraljfxscqvxzxsuhedjirfegyczvakntkycqxxuqsuprmlysqhakofqojrjjbzdozhgxgapbwgskstciafsrkjfvapheqmsptaoccddzkxjeqomttfkfqpcsgjywvqopsctviwuuvfymvkhortvhiycrhapftdwlipgqlcmikkufwdwowtxhrbybcpgvvcidrpvethmdtjlpmhfjadqugqxifffchofafcgylueefpwuybdagvunntvuydxhrehwhpwukazrrvlpyqsflmsaipvguuolyxjhniczkdqcyetyuldiaxiipfojzexacghpqlqboidomwnhispkqzshfiqgnngpwqgmbwnqesgtrtabmrleqdlxldeatmrrcxfgvvycneveaxhoossgxfglimlbydudcajavhcilzpnwwbmrtuoaazjmlmlqhqshzseiwotxdjvckhteeheejprueemlwguvbydzmyxshswscpygyemhwfdajpnhyhczhhytivnpqjjsyjazqmgmsmoddblbipcpxbkhyawqjiiktkjjzrxrflwjmjmwbpnysahqafhjnrvjegsdaswfdsqsedofuefmemegrnrfhnolviovakdgetaiyonuusgyeneyawdjltugdkegwhobcojdezxztgzatgyvcdhpwbxbobhkixlnlxqqypprvotquroyuvpsynumodzzbmmmlecjvtdtiwjeozdiusdvhxhwcgxdvlsgpwqmqvfarrehqjsnevilurjwagcvrwbistviockitprkyjxcghqayzzygdtzzvirqfcfhmpbdgnesmgatydrycqgflheipxzwbggovjtdwxxigydedwefommausilphirpohmxasvypfepiksepzvblvvdfhvnrmehvrgvjbvagbsqmmwdmrezmcfslaheonljergpseqafkstwowiibkwfpoqrxwfnhqryyjsczukjmdfcaqkdchirxakxwpkfhbffkxkltuwfxehxwscybkpymzvkqfpzjuevtqjmkfrilbhhvkfwwwwjxutpzlokfviblrnwyhgkinrfzzbwxzhvtcmvnbhvwpwjilfhsntadmhclkyjkfgdksaxviutxqdgckpuyixbugfiretblzgvthvpppioilwmyliwvhzsoeafktgwumtnvqckinbqyxcwlkugstygaankttinhedfuhrcusstswrdjojbjkjjkyugtcvcgyhdgzfaravlwpohdaimktwwtscmwypdywigvnjppeaotrvyrglbbjzvbchxcwcctkjqashpykdubzssfdvgowbpalnchrhccsvekctkozepazjhegntdridcxilrpovjlzvnufctmttlfcpnqiqjtwnsgajxqegbdbrygvtuopfvrvjjfbsyxhrdkaaahickjtksoemetuakpjwwmqvkyopiqskxamkkhuexyqctkegbpcybsvnsjdcbvnzvbjhjfligekzoqhshlqjenwywbbxwqyurjbcpnlvrxuhqezxprgvefucgxcfnazgkalbpwwivqslwtlmlthrydwhaampcnyopjpfhlpcehqabdmowwhxzdecdsrihrwwambjxrmbaecbhqpfmxcmcioichqjbmgbyjlyczzdfbeoswvgvysziihlszwtocwomjmqkmtrpafjwdqtbksjvcwpdtkrxiglsuceivwyvdjtgbmjohvljrammmgkumvogztpvrpswaodeaosjjdsdfhprnblbzajyvavmpqksenwgcoqntkqytirglehketlbtiplyadepzntpdhkpxkjhbptfzfmsspnbfybfbiwcvqtyxdpwpyeqqzyrgklzbycgxdnankfiayizeyvtybmoakfjwsixrmgqptsffxnfywgcwcxudjjgvqrrjzralxscskhyixfitmkpqjjttubonsiwtbygaqlscuskrysmmedcopxjjbzytjupksxkkifnfxzyxuljyqloflzrmzpfikwveuhremejmfijzvtalgotrqkdpblznhwsdelisrtewdowyjwkpmdjcpmtqzvehrymxjwqaqwytmuuvsgnhlwjakfskayttwfrhejjufipsejpxrcecypeluxvwvqquxhdbqnxxxnpbyfyqjcukszvowsltibpfktjcggzdvrgwwfofjipdjmshefbmisuslfutlvyjmfhkkvstfhxpwrwawzpeslydquxdpvmeatomqgiwqflmyjmwjdadoaieufkldwpfseuimcgejtqhdfdoiftzfbfbjpmmmctginqwpxbysthxymljreiyinzrdmdrqyzampydozejvngtaueraosicrzhfcaxdzzrqyuhzaquoyqoswhtlzbprbyyfywizvbrvwyvyqrmpjajgicrjegaheboexzduauqyvnxngjcqmmwwqpfwvidbjufitkctgusbjrpqatiohekytsuqaatjuytpkvkqsesdvjvwedmmjxmepgupinaenvtxseqkiiogtlexpqlynxdeezvopvteqoejuuvfellxxpwofimvfrzlrvaisvmllswgmtlqfypenmsuugrbyrnropbgkptvipdujonqocudooykurmuibnwqofceyzoqdiztvpiylloblzxdnsnohmewtgcrfqhkaieyzowmbmnplluafhomvsioamiiersfaydboboqnbfbobbtiqgekqsldcthunouorvcsjuinbjbcmvlcdrptlayoviikweyqzdklxsabdbdqyqubhjxvlxjiftvexvuyyejyzlzcncuntprcaoxmniwtbrzynvxnbilaumdjrxykopopfodtwboyvpyikxxlilmcxrnoqlahdrwifbdberbzgahsxhefssjrjygbkiipzgxehdimujldjvxjebowtaneyvgkgqzfxzmgcusydgdpdbyjcohyowcpskzabbfyatecnzcthgimhgvlucllyqasazsdcadctkgjljcurmgaudnqhzbhpdarduxfwakqmqbxbfrurzuncidljhtykvrproxorhgdzhbdouxhusuycxkleflpccgttdjkkppmyqpmnmthgnhintvtygkclrweufqhxftvyiklwfudtdlixjbxpmaafygzfyicebaejmpirllmoyunhylzknbrlissgbxmcxqojhwcsjpjhjwphjotwpkjzfcigbwkynyjuwlpfaanmweviupelbqnguvovrzvgxedwrubuuqiqwdyqufcwxrermtofujotprpintchjkziqaykhcietnxhilpcudvlwntjgysrkrbaralyeteyibhsmwuibsvxhpippaizskalknkqiqqrsyjeugpwakvhbeyqggqyqskcfwtnmlggjqlgyceymzhqfhgmnwmgqykvufljrrpajcghgkhvmqltxrhlqutgsdepjpaairasujbcvjxhzidxckksedazgeopvqrehsybbbgykdimmllovxicaidiprakhrqqjqumsaledtsrgfhdcpfcailpbnbkeudokxcexplaifsqlbunrbstmdipslcwffmscpyzejbppvfcxbpqdhjrmtgeeibknnepecqjosafphhmjyeognfuglznwczlrddwfthvnjadqjrbiwpolwiskjhgngrhjudqqmmdvoinycpgagwldgfnqmtfsmmbjruzdgeawnqurfarlwcodidvuwcplpquimtosxormeldlouzkxnphrmdppsaglwoxpcsptjbzufnkbmvabmhublmsfoyqlooatiportpnacybovesjnmkaycgncwyrmakwsannpdnsdqiyuchipuipyqebpesdheazgpovsbpvtavqcfatzkjxbpaquutdyveelscdtrboryeudenepyesoeikzdpzztgmlkpgbsuvrzrwfgdufhmvnwhocwqdpypaigilzcgsdxqjetflcuiqspgulwxcuoeevmquowouwedcakncevuzkbtxztbwhfacrqyhnoblvgnvrazxxwwjxsgynhuwoxbfnzocqqnnyakrcjpzfniehqfuzbrnyssmthqlzeyxgipjugkbttgblnxloqynkrbgarrzxqyganpuvbwpuesgrrtfiruukvakpslmkmskbjhxlfohjgpczijjaeembexqykdiwxvyjevujjdurtwsdhcdliqnopfnbixyisyrytnheqbxjzpnhtsubkjqbpddzcbjxbavundaegxpgoepizljjvbnmgqljtvguxbqlgqrnpitdnknmvxxqakehcqqvnwpmzfxgxqtmzosoafcvebofosmqkemzcdmbllhiccxdsrtswvodweimwudjaricuudfgnqirpnkigcedshbyrovnreniopejtmpiezztolduqhzkrajkoeyhklrybwjwiaembfhprkljtktmncxdivluievjaehkhlyithymrjvnwqbjtymdvzyeevpgzxrikprdzprqaofyfhhahwffvdlbaaicxbkksbprshktvprcybcixinunyyoagqajckbeztwgdreulgvmldltshisfyunquwteyzgtvowpusabpomsbhmirgqqbdixcbeaaktyarnvlpwbdkvgtkqmqgetmnrooxqrhjrjceepvcqaooghywwqdamrnffecvxlgoukuzzrdsrsgxbgvxyaykrnrytttsebgblccntffmxnlzvhwthwgbmxzhtvaxwiaklcxgietfregonfhxdpyppzziwzhthifukcdsgyazegnslwrpmrgbqflpgskoapkntpfznhauopoblfszwzcoendlipbienvxfdyukaoapccbjuchvhwcubncrqnxfkvknvfawtalyeojbtrwapywqnbjfohlyexozcovyqjyvzhysywsnvpgkqpseydecasefibdzmdumkuelqxanmgyeyskyvodxjherkhqxmmjxgpkxmkkarkercqpzfszqzdhmnajzmuyvjiuytgymrfdvvsxclwsmbcaocjqqfolrzhpsopehwjcsbbwozpbbtbpxnhnuwblvicpwsvdqeiiflhwlwxmradoplbmjezencvlwqroubxbmexxcwjvzpjqamcjrepeikrgaiuwjrzwxxvbvhwuwflwuphltwrdgijiregcxfaveyyafxubehzyzgjueaymlhwelcgjhjgoheombkpgsqgtwqncslodvkhgmqrvzzjgezuhklpebwxxombgapkvztdnjxiiwuqctmkdxbhyzgxntywvngqobvblsmtpgmrbydfwfowgxuwsusniadwbaamtmikuubvufcsmtpuqlqifkxnkcmmcoavakfwgjrbqwtepkyhvrrbboqmqeasscqsnxotgiwwescvcbcyuvbvjrjzwjtoojjbhzwpjtopnqkptopnjqlskutigpyuyhxhjtxuonkbdwtzliowbzrlwktczrwabtjmoigfvsibpbacmqynspaocvqdoodrjndxvmetgnuvqwzcmyrgprurokvdaaujpahnmnguacstyrxmpptfinyxataawwklwtykggfjixegobtgsondblcdfeedaqoxlphrvocelimckhkevxhzilcppisqahplwyftnjxasmeetoiplsqudujtdelflarjywenheozqsdjhoaugqojnaeqepvrpocqmgdukrvcmzovpopvheguglmmcjdsyhimnlgafecrfsmuhbpqhxmpkabnjghjnrybcedjihanaojjsabbyptkpuxabemoxkrcqwlbeoqgeapwasaahtlwpiyspkjmuaqnzcodselwecvhuvhbqszfdzaskjggjxtkbhntoapscmzwjjzzbaheahykqhsbgmmjvbcjcteegfdpocrqdawdhxpzehamvovtqxeusiaaodseijwnjtqsqhrwqtimkdhcclwwuyxkcrqmanzlgrfyywworgcbljfpxbltakfebvqdiroqitogrmwlszodkushvgcxqhdudvxlmmcuhscbhzmzyafkuzusfwryexshspuhdybnreqadczdegpbgjvnionmlfvgxpncqqrhuhhzjieqrutxfomneabqhwyeoljebanyiwztgejxaewhujvzlyrsvpzlairdkgbscbokhzijegsyrnxcmqvjfwwhgnlqvmlzpzjyytjeacdrrcwfvrqapmivbtnwhavzbhzcalgcnlugqqmljclarvxuomrynozovyqwjzaykufcmtnxvbzowwjnjcnyqmmomfkyemyqhdtvwivujukitvxexkcqyqemvqkbcjulophnxejjavtvrqzocbeasimpyzrbknmacvnbbymeufzlxzbzagbuqqkrpduzqibsgpthpgnjnnwlmykogojyetrtwlumwvgcmzlehznvmmgamsosixsmqkhoxdctbixnkjrrkhoyvuyhpmbxktmcfttdxvyyewnofhhpqwnlsnshzvhlovowohznexlivbyaigrycgjutdevyngoiwkyflmklzugavjibcifjtbeyhzwwineexfklrwysqgtlpdosovdhxhggjedrrjxrohehdcawitjayyumvzusicbrgekanirervnvxnthicjjcfvyersnvtgczrcnzvtqqgnpwiygnippplpueihadnedgisfdlyvtnkrykylunakaqehanhdalihvaoynotjefacpynkopuqhaxjnepprxymanmndfwjkznczcmnsiebiblvickbzjqzycpdilnumcwmfkzzsfaajnvtpgurrkqpnhsxvhrhmqtravstautlirezzzqqljhyqbxllrvxhoojjiemcaxkrcmsdekqnrrguotffocodsaoaecdgapxedrjibzvuqdphxuonzdstfhwjjbqlqpruhaekcbfufubeqqrpvkjarhjcibqathwakammcrghlincaetvoevhlgmticwblsdvtphxjqgwataaxuxoysvmyjhindlzwqurieoruwnwpowmkvcknaynjgyxljwjcsakwqbsmqodgmsshudwubkejkdvtzevrfhqxkkmbzpjnjcxehtyifeuphpliticasuacemfddptntqtalrktyekhvxqpguraorcsfiyjztyslruykgrkncsibkzjgrjukmoqwobvhzpsslrerkpgohrqtqzzjjvuxjktalohmfceqvihfzqughmbzncjyxfvjrojeesqjuwbrglxgbtokhqjuuutszqdshowlgoxdkyurltzmonwvfisacluedxwklvwtjvwwvtphoovdduajcslgffmjcjtpgrirohnkcetsuqvykyjoquvyzhjdscuawcsklhwporiiifiudrjwngumpdrkhlmdqgqbqotegdoqixkoqvkedgqvlifsvtylaqpqeiwmlkcvhnjaiveobwjmgqhcjhnjxcbbmxozksvtfgtqcxefupucfbeoisahwbkjbailtfeyoyqsxwxtltwquaheuhlrkwclymyrsfsidiacfzwstujpuqurxhijfkxeyvvsanafyckfcgxxagmwyinxsxhxjedibbacqbjoftthbtgdbtaadpxvpgvykyimzjqqmzgrvcbwvhawccygtwdicajpzrdactsoubipdloasqyxsxfnviyzjhqkytmbofrjgbalmonheleykjohtmhctzmttzwhgosortbejolqbrqoaevtseylemfznditrbjjwkphacxetqsvwpqpwoaadhbqljmemvpkieskirobhiyeypvufxwifzbsinyxkohuuzhdrvgagfggwbcdzyogzpajeygqoonlpuqirwjxdrdbtffufvaekcoqaugrktcanskfqvewnixinecvzezlipbimibwdfytzjyqecotmlbcsfxtjwfrmgcaqfwwlxpkgncmrqgeejgwpdpabwupdwpvdorolgbtvdhnuntyzbwoenohkizpgomkeeapmdikhqxdfsdetzuzojgytfpcwcoagqsuucebudgcvjiqkdpyoyzjfoldqbgysyvmczpxdvzaghtqmiqaipkogxrwzxxtxsfarwzwryzzhupuchwnzibfgudhuaatuhtodsmwslvafmwktsxsdaxjudsqfskazfoeaaasovuvhsfcnevqgubdxttdnffoltsltsfjpafyumchrxxxuyattwygbdumymzsgfdxhixbvajoziltjopcknjntfcrublaipapxxruzcizkwstkhywxjlsonjipxlxmnplmgimkqlumfqypqwmziepxpaomlmaadmmjuyvmjpbphbgxyswiyofnouczicblonwkorzxiaoqbupboojmcrcqnervgsixhgjvxivhkjzmgpnwdzlfqpxftoabikapqmlpwgwhrwvzlkyqjjxbyugtkiwsszjklwzhewoyslxfwxvhisjgorbyaasuzbfkaetecicuvcbrzwziqkqebueduwatahfalyeqijmenoxmkwwdgphklmpfkpakwhkkhraqcmwpatdnscqyrzkelajwpliouvybmarqmpfpjkcbmubftojhouffhnvbitdwvwmimtxxgbasvdaqrjxhgennskrceuzzsnjgjifpjfjgljzcvykddzqvjhxpdyryocgzlmowtzfelejicvlfudcfncxscoqqszpdnfcifhnsnyaptnxpqbwddtygjoycpohcvjlcsaufawxtjukcvghbafjjwhnlxvqtgbvbdsgdofyabiczolaqrjcnqpyqmojvrgwuyezpkxrlfvkwgmmxvqkogleubpptvlpwspncmepuzaqfmefkvradcexevnzsaoosfbwshmmgoeoaitmdmmgpsgvnvwgvmwqsaokhayoocermzdqlsyckezazvixigpagdmogkewokpajtsunrzxxyzzuhwconewqqmycqvqakqlfjischsbftabbyfrllnebccdszvvmoirzqmdzgehzficdqtrbjxdlzifbgcnulgvduydackahscnkygmjdrwebdfhgudtbywvwzwzjyiecxocfclitjnvnuetpimsikpfkngvlqbqosstugeoptlcprxeblykworgbxdpnffdxzzrffhxyuznmxupkuzgismmpsbfxikujlnpqvmornefmyvxswddpspekslhcydljqcanqqfeumsuhppevutnlzzdnihlluudxwrnnytjkmeudvayptnaumfhumuhgplfnevaeokqcqkgnkgcfueagjjdxekfvxnidilhyvybnkjavpeclkestoxsujzphmzkukuthswwchwzycckmgehwbbqkbhtnhgiradbubxwkwyiyasniyuhzyxmzhfmolwhnbihegeocexcgrpoqmvpkvdlcjxswwzkzkreqxsubrwhjoyzavqmsuxufwmbsonuyfyqeskikirvwpwwnokfkhcpeqtyegsensuslgaxprunjqmwewdpefgkwzicgdhtvdnimnhdhbqstcqaztpfbxpxxxbfciyyomicbsfktxcpaupboggrdxoawpfzagzquhsvzzivwmkyhbbxhhokeeldvscxybnskhqmiajhmvfvwhsdqgnxkaagtedtftorcgdlgmsuhzqfikizryydyalterplkdcmliztutnetflbqucjscmscamirbtbgyprgrkckzidfuhxojgiouaqumblpuovsgmyxybhyjnffuctfibtecmzqnkgjzbehqeeohlotatyuvscfvxkzjjqyvyiwbodrshiavwtxqrsnlwvhtfifqadnynkabptwzbwuaptsilhujcddjlizmnpmbzoeqiaplylnpffysnucrxhbkpcwerlhszmjhoyvpkierqcjdwlwvsxgjceotpvopjxyaxtpjetauykzwxvsqvazxepswlgnwflwdhlonhphhbidydxoazqzehscuyprecpjjdxwkofrpnwotwcvvuvbcndwnuptxfcgicfuqmngcluxhysfvngzcmxqgnjduomestyifnqhymeinxnimvhphghotqtpgftyytjeibnjourbrglfbuuladbwwulcahdacoglpuufonihttownlhqoimkfzpfishliowzisfyfnhajvyyggqvqchvewcmqkzyyxyipfiwuryfmxetfuqxzxtfuxrkjrljoltgqbeksdshawchssetrzynxsaijlszylhopmajpsqrqsajmeegedvdvvngifhgtpwidzturmlkgnvtrzbxewczuqhcxrlqihaliwfcismofhjwikwnjaodqyfqpsixcjikhpmphadohnmszihijvlbvtrklajnltasimhrnmfwbsqbcxlnvxpqsiddimtvgvnqjwiylpxmhnpmlbzgaoyszbxhosfwnumzrwxemusviihvlhdnxbfwfegtzlrofdnyalemhxhrfrmsyrfxtmuasctrpmiwpvvribdsynjfewxenebiqxilbdeqpmnhikyslekkrurxsrdhvesoeczfidwxqlgavfuglhscdkbxbeeykymobnwjrsijdplawfghmblrnooqstoctdtuqpdjjosofdoblwkzzxrmlhefcvhwycqqtwackuspagslfcmebftmnxrpsalsfejyajbmfvdfcvsjzfnckiozghpahctmgenipqwulzanwsyxzmzkunjcuadefyslefwtvsnhspwqkvojjntfbfixhndmnyardwmbqzkkribbdpkoegwfnefwtkjiijbmhnpzozkfhnincvbgbxoqdvmyfviogjcpytpnsbubodoqysybrorxjdxrbghjrlzqeqfyrzzfeqxekxhbmyaxeyqfgzqxkppqhuoyuqfagchqaotonuntueaadqzqgpgpjxofntgvynnadgoqcbjwhlyncydkplzaingxjouhdhhgqxzsakrkwrxyrcigpjhazpziduribaotxnozafjwyiuqmeycnhemydwbxnlbpcuopiorpznqijgwngadqeroioshddktfhhxpxohxexhnfddnegdixusnmcrrmmztvyltosssrzgwejjirptqjnexrxoelnzgnmbcgvuxwcvblhlewgvhwzenystjivrvhvxoqunnwjqksbookjvgkzvktpvdmnztkyjasxprihbalpqvbndnoyyhptnbimxsmgvhfmypubrfshatwfjkdhuvchynvvfhecqjpobjrsokcqdyvmlavfvaounjrusvzlhozkztcpdefgdavqasvysluhwleqjdbstdcswghzlmhqocgqxdorokzmyfcjiedbhhvdnccyqjqgoywnbnerxfdvkggukjxrquweyyeojxwzvtmxitqhyuflclhmvhflbbrabwqmtnmqiapqtgxuceheqqslxxyzaqbdorpjgdzqepizxitzmcfctxnswotyeubuoqdwuenavvzsdvtqxyusvkltyerebsypldlhhajfwixbfrtdroxnyiiypacqucfhfsqotztrktspmoudcsscabcrbehxiohphxdczztjsnagbvjfncjpdlhgrqfbfmqmkwqlvjupywvcrgjgivynihvcxddcpuqbqgmnriesfbwyhffscfhlmfnjisoxmebenptgyxyfyufickcerjrdoepwzdwnjzswonfonftnczvelxkdjcixixwhauvktpihepwrvrfxsadeanjjrriapejragbtvmdcbbtwuavndytdmeofvwfmdredxhzvvexxfsvbttowrjzfnplllsxojduhlvcizbhgtfhmyyirhjxvykgmcfaojwvwrzesaoattkiriskrchmctuoycrmlnjjhipbkdcfymnrwgcnklcmfwdfyurljcwskmuwrybqkrhizjvlxxzcwchwyaiicgcoswmmwnciglqhvmsujswfwfcvhmflshznglzcabnjodqlplfbfbibimyradctlbitohxrkkayoskfdpiitrmdfkvgoxbbbjwpqtgcgicwbmbeempzfbeknzsbzteaccruwaweizalnbqtphuukzhxazbzthbxkvsgvqkfrmrhpjafsvzcugzuicwbkzyuuscrlozcaqjpbmwthyxdgyzobvrlvqhrkjlvzkazclqfxnyelxhrvjiwezjbrqvcbgzcsbbunuzkjzpwwyprhxqoxbrososvuuymvbiixhtggkeekuyutokqpbhjqbhmvhbrijbgrwozgtgtpeniuxblyivqlefhlgavpddiaskgnqzeuomolnzmxwcjcjsnpujfxmpxgzgvphzjwozhbbvbzamcjgpzaagxpvxvvdtkmswigxskynlanzcxftwhucelxdgsizfvubdaavmbjzbyydvfytmsvtfvwmphnucjxfmadyboycmyhiefbqazlfuitlpjitshyehddirdmebtohzrybqjgmtayklgddnekxhnfbsshvnvdmmbnfmwriyrsjzwmpcwmlltmfltbzqenfhdmtbdbzxwkwuwlwvxhirwqerrfkxvreydzzgdafzkcvinrflaqeygiqzqcwltcjwbkegmkfymcgbtomweswmdontqlejnphqbmxnyelmhtnchcynuxbxloqezwpmlxfolcbjgoxnkkqtmqhhnkgbzzfavupjtuxgwbpermsbzivlaesqqbrpawsvsheobeuzfmdwavazfxlidfytgpjgndehkkvloqmvcpsenuesrpauwyndpylebpmnahaqzmmdcgipamjtdmnzmcecdqggfuuhcuydhkhlqrcsfllizajmcoqfewojrirveralbjytaclfqyppyzbanrirqwajgtgkmgynqwiszvyptngrmiuzbcsravcgqiqdpoqhnbzowzdqpljbtddxhvqjstpjdimuyeblfdzecewrqfvllaiuxzequvzxflservpxyrddxzungrbrrjopkshgpgevtyzktqjuhmxfntuulvnehbvttcajkeedefqxvbtdoskbmgxzcldlmbegderokxtocjoxlhcbaoeovcnzpskbtojzvanfxiubsizfrdirsmfnqumfnwjimshhtwnsfjwztxgkaoesclhvgtavrlfgennzjctqlppgmxrnlvhqgploknlczridexepcxinnzubxnqiiyaqplhzzsdajnfpnjhpgpevoaxnnnwxnwqekxglrlldzsuobbdhshfjkcwxruvhtnldkrqbddgevbuwexfxgkiqoeqgblnuyyzkspnxsudpxxnbwsyefgvtnlboyokypjkjazgutjjsiwuequivbfrqssgshqsybchdcnxxyiqgemmwgushajzsdfnkxfkairdmgcjekbmqnynuvhdvsfpvmcgkiqmskqeqspxftjvgkicfriajnrfzwnledyypqcgktdpmonvyxxdphfyuxdwvqhbwhzlxdtkwyzlpmgnmftbpyzjxdhuvpvryufwzagyzhjowrdiyylnzkzwpgtlxoewllskmainjtdhkiplhaygnzecgxpdmwzxjtjxvsmhnpoaaglhijpvltartrwfpyezrpypjlwxckxcqilztawewyxpquwhsailrhabuwywjvbbfmcanzfjxeypywxswhepogqkdoholipswutjtauseukfqjxoqbehiwrnladyiuthomqjmnesjoxczvsrywyivsvgsagdvzkjnctzrxubnrfmmxfnwevrytzqtfvohfyuktwbsqefhjtwjylfegwczxvveqjlyjgkeelwusbddwbmvmtztreuozptpbgpmozrsnnofrsknvziiskdmozcnrveseuestxlilbncvaprzabtkehyfklwhpqllxehurphufjqfbhgbizlohjvtwuankmzjsigjxndezvjacrbmtocaxyvvsviehjobtwkrjqvinhkqynerbhtahovbmgfvrvxlrjedbbnpiyhjllcnuypdolearkwkhtvbczegbrvlrcudnzskzhnnusqneoynjtontstwmohdqeggfaqeidrcxjsbxqpgjfueynckcknuqwavyqbgwultedxdvokgtglttpfxbvurruopnryjmleqqbtlrfrnleghumgvjapaxfrkxrvjezbwdwhwcbjphsybefznhqpeviqsclbgnedsbmofpywxqvawcbllrcqnmifowjxlpcdqqrxgrufjrhhvjugawyplhxbfgyqvctotmnbgjirapzvyvebscqfjpgqvhgtjbjeowhwipnkfoifkmieobjaqrqoyzjkasqqqymynclustcefkivntveloslnbvnvmenksozwzwpsatxkesaxqekeyytbtgwhmjthxtdyruqropdukdtajgghezixhgfwsydrtgqmdgfrwjngogiamqhqpsqyyvuqvxirgadjgjceurmkxukmkucbmsampwfnwpeepjnvurcokobhllvxhyztsbikznxvedztmoqhhsxrjybumwrtuspptxztmyqqbqjpebwmuudduezgdqcxjroeqpzcpqsqgdimeeaaagfvmedpxfpgwdmovoqkekdmnlaupbushantgqjdyylwdylymbjsoogbzgvqhskosxiyqtcqrpmunxtbbevpubsviolpgygavqanjedauqwjprnsxihrmamuqalyytavjajsfoubgrkyixqgiazucmqsodsmzujiwudbjxerqppboghygiuiwkckqwypsizoecsncwhsnwtceccmlxwhjauzwuqocsdjuvwwtfrhcmlipnvckrlwsfxqaohegmpcjobctsjxewgvkdxwulsosqhsgqzocoqncrpylbvsxbpjepgbaarsqanyqomucfhhyzfkacezetlkitnktfdmhqkyezuiecrcbyodbuehqpraihlcooqvgcvmbquhummvmcanxewpuqpexailqyiydekewfoqtanhcnvbrrqnhgsgictbdcbgimketywmajtfwqgpkxdtfxcpzvscxuihivnbvjpyskdqbjgnijipikhjgbmfxwnftagrmvpegsvjdbyomgdurmdxorclqrrluzcgxtmdnhorkmhyumulzaiptncjetxavzgsttxiclzpzgnttifuipjbelnlhklclswgntppgqefxuaschomzxpdkcqtocxawtijoxauofbnzchdjvrkugogleazizbgtkphjscxxfmyhtdtqudmattlatnisqpncgxmyblxgyxqtajkuowxirkimxshqjusqtequsobqlrlocxiqwhynsiarbjhkfaczgttajwqupeitbtkzaknutpmwatifvleegaepyxlqdwjepvgrgvmbmaxmthrrsyxyabpyabodxakovqhblvexvblrlckdchecktdlwtqvtajpstsdoxckanblslruuxxescrpvikpiwgbpygfxjpaysnqfenbbmguoxljhxyqvetmfbscmjelesdlwqnacvwqujacgyuefnqkokodutoalrljkajmxhfsqfuxfobmdtwtenwaimavgneqqqenxjhooblwroiwhhqnwonebpzjddzvvditnshdtubnkmjttbhrswvvmwerbdmxiwqxoxdktgxdsiwnmdegabboxhfzmtwupmuglzqefphyzflnjsvltybrfgqrzooqaiyljorofymhfawossblqcewkuplidekncxwtolyozhubektwohmslkdiaosfudvxcrqreqhgydheqbaekowvbzddqwikbdjdxzwbsgjqjrwzuydemcbpdhsvfdiggrlftijlosdzjzzfxellindmuvhzyphhjumcevpuqsuztvhsbsdkfiybefcexjnggckkxzfnrzpkwwexqjjwshzwnccmnsstucetbjjukyggwkfmtpklwkjlmoxzgrvavzvykesweacakjpgybrxldkzrkbzbwbxxwxjbqffqjidszjtacsofcpymqxqoypnxmwyedfvmpahqjcrluhtywrnprdfpsvoetojxugllgucrwvescxrarerijzxbuohncsmwyykgumzrhejlbclsidcreauyqcnsuapvabdundnuhzfkbsfmxhfbjabzepsyrjvrkznxebtlaaxducpsmvvvxxxbmpbfazwkyjjcmepmgmqarhudesybpvedmgimfgyfrhjenyqvmiwdqsiumjydecitkshrygwsphwdhoyuxwzprilfrljxorsakaskgqcxyaafpbbmzbdsloyeajdqcwqmwkzebdbbeegthihilkdyadccmfuobldzxcdyhfblligssnafzfdciheumzjqmopjstkzallnvrfphhugnzivgpstodjcraljvxkxlvkgprwwbseqspnyeftuiewbfjmajxyusicjayhdtmtlbglhofdwjbaqkmrvjrpezspbsxeljzymgkvurysczstlhkhsbywcsmgnlmywmziujdocdiecdxnkjwcmvbrppxccjdyxcgrnlhpoqtsvthfeejrbmiqdhvfsydscljrwrgmjbeewolbswstjclolgufgxxklhbhahwllcphqcikycfjgryrzszgrwqcfsmfbiqomhwdlgpkjvtrmrjllktfgmjmgvtjfkystwxfcmrnhmfveqjraewgqguydoklyiftecaiqtwagbxmtgdtlcbdkwepkoakwffcjgmazichlztggxztbdylzcalqbvoicssifskpwtdvnjdklwnovapxaaqdxemzxekeywtupwrcgvortbhqbwqeygjvmxwldgpbclxuhrwponihqpyunqylwhikhfwklnmqylmieixsxiaozainqiaorjayowjbmxtmkfupquhncjdblnqbvrrpcsnqqytcvnrgulvkfeajodnztddqwwfyotqhrklpzcvtqsgvyihmnuogxtxupcugxlnpvagwfbrvvxsthzivtybtrypidjoaudrrexnjahgxgytoydjtbkmuldcqnrsjwkdcjqnmxtleseuqhdjkpyecbjsqclcyxfbixouxigdamxswadirbnufyoxazbyyizhgqddyliayfswhveyztsgrjfrkjsjrrsxhvchhkhhpbdyzhxabriuanmlwewqxophlsqueabwbeucotcrlklnazayfwodmgmayeueewaicxksqnjdzvrburccqqheytgwxbdezfmdcwwvlfyncpozjqbbjihhdogcpjgqosttrpocxopzggapwbshlbpopxtgizwyusrnhhrewjgcpgtnknvxomoglhmtilrcdlrmsjtosbshjlutyrrnfhtqohlwudbzosmibhztirarfxldqesylnobxcxrfyrvtfdumeouwqlbpygiebgrowslysffsycldigpmwliowlgxsodtwvjspxthcycabnfjvwvthgkftqcleggadsuspnctogvrvacrwzmffwkzopmsxvuanrueeyxueulawntunhzuglvuaipxflzucwyjuxdbrrdpeyjtfkolvjiwtxtyivsnrqwlpboisrxxpiqxseioqqkjpfiacanttjhkkvtdpscedudvbmlrexawdiwhljbgsiqefljuglbjieejssazpavulrcycdgwnyaskmpszqbhuhqpzsopvjjiclgeqmadkcywonoqdrxzbqoaierdndlrqtxhfzmscmqszfieyggzywagbtmqwzinthwahiujvldwsmdqujsshuainobkojzjsvlzfgicroblcebwptqwnshdhinxtogljrlqzvtsludnahlpabnqwwtfgiczyknjdazfxsxjobwoiifklvchtvmafqzfcooioonmikvxntnvbvgnqiwjgllndltgbhqqxdegpzfdusywnglfrhrzucoypjgrtwjqznwqodtiwuglcrrtbkuvolteuzxnxggyvepjiiteearhrkcsuxqlilpenoukuajpgaaoituptmwnyyhvxxgfjvmwjggfirworwdcpzrllnymnfhlfnsoiektksyskwjdsmfjlwwzlwlzcsmjfexpjjkvdkqpgztynajaxgzkcmlggxpncoenxokbyasgblgomqplyqvcfjjlgazirfxouiruikbmxhcjxrwxkuapdlcjnduejtvdbozmaayyiajhugfgchxfszqfdmmmghrjvqvytvwbyhkspparwxyqwpybdkplrgvozqmsokvmsfgjvgbtdzmbqkdwwshpbcdcvsulepxwwdgrljnqkbtdlyzjtiyundykvuvajsyfxgzkpoccpvfcuglnoljbohlmbgomamtzvujkklobjtddzqsqbdrskfennsbqgwpbtbodocfxwkcxbunexhwjmcyzuzrbyherksuyvbwrmaopvevuluexwcyteqwezavjtrjothhhixwdbtxmndlmimfmedsddnoygxobhvipvgswarlpvybfkitolltpahpgheiobsdwzxtbqgqnesspalfmwzdwgufpypdahiwihrlyzclewgvwrakqzpoiktxkkdmuljctcqtesgiomfmefzuhqirceonotzkfkpapfttxzdnmibspcowtynvcektxkdewsglzbeybhlprpjhrxfmvviazutyeyfdtlosnvrqcehwtqdnpizkdjmeeffkgknbvevizmydtfzoxedmndzsolzstefzoualyvuzkuffcevzjzoyenssyrnrvsslmuxnstmeprjrygtjfhjjubeutrmqjgcxbbkvuzzjskdqqwbydkjzonthehzpobnrezmyynkrxnjpllnqxxpnmkurswiixvbcvncvaomzdyooleekdvypguiaqrkqolulawhcnvdqvrhgxlrajpqrjatctdsiqmvqkeuxcxoxqveoivotmgkxhdzagrkydioominohdmyasmlpaebjpysuaudrfbxnqnbaaskggigyurpwyqfnqxjqumkzohoguriwjscpclpwcevawcpncbfwnrxdynjueutqovhrixplbknypfnrgupvoozobijheextbfkkczxfmkfbruuxrltfzutaeejjihckomusnrxbdfevzauqlpvmjrmovyxefbqvpkncdmggrkdtlajwphjbyxrvxqzcrpzgbmkgzqpsdslouxmkgxngxebuwdznsyvwlhcmargdmurgtfsbdhhcliwhnxwiwrejbixbcdeozxwscpthwclknktahsidloomxlnzrtpqqllvceebjqnwaiwhafnmtdysrorihgaaulvyszzbrmzrvvbxcqjwtkomyiuhqxhmkcleekhvzgpwcqtgidcdptqpdmwvjgiuktaofimeobastwzdzdgqywfbjdxujfquarkfzwknzmiuihxjmezlcgonklitsynspaaqwmeyyosjxsujwuuacjomwygryvlovleuxksyamhxedhcxddcotoltuersphnbohaabybohyulhxklcmzxbmqxshpirflfmlfqmggthagoztbbfdyirqikaxsrcdwrqdhcmpytpgjpzlshotpfjzplxjcboaufgdjssjnkqwzpjtyzmqfypwlmioqwqkdwopqiydsoctglnglbwsbmqnaydqxvdautpkbqqwgupofevsirmjddyeddwazbdtuufykxurrlhzqcryugjxlidolcrmdwhaqnadkwwchdbzguzccjbntfegjxtmtaolpoockkeuqhtydvaggbvzizhrwcgrfudulrwvecrwlnuriuzovupewyxsbdkiapclgbimfaitncmxwlnufcabcxwdbildxqoftyuaycvnhhkdszzabzdexbjajxdiptoirikqmgftnsziryivalbxnkzyjchyvximhtevzmpoeqwvqgsqstnhgmhpqqqnnyawrgsssjjwzfupmmggivpokwfcnxqcwqzpytkrctpdylumacuialykkfmxdebbucqvvamztdeupzipdfzdqxpaeezhibifdbabbocxrjtikbzngyrxxgzckzlvcwafxaiaonzhwsqgwptcqmbnvdrhcdcebclaeucujccfwunslgvdvyrqbixdnajqevqjrtfcvjhrdumrchuxhnpjyponpaevvugonmqkvzebvqsxzoxgcorcdgpugtqdqwtdklqgkwjfobeprdvvspxvvpqdiiiygberowzyuifiljxcpuahjzegowlzetznwdgkbfkxppfcbegqbgzmgdvwagvgcvtaabncizzxphzsngkqojdumyrogovkjqlkuaoczpcqybiojseabhwqhpeqebanulzolpqnfsdfwmthgyhkhearvghzkhpevosiekvlfzqdnkktiudrafivopxyxmcsawagiytnxkqkwddgzjxzqgwextcwfgoicrqlpkaowryswdyvmxwdfsjdmmztsqdxjukaekocdouzruwgrslzluczgdubvyaeskgyuucyiwxcsuilotkbnoawuxzpvzwpjcpdxrdhpdlhxtunofpcvrapozflabajdrocksmzvxiutdhhkwlhqlxemeqmfsxkkopwgdydcgxxlgfxfsfveczsirhpkgzwuqsavqfyzcvmlckqvrnbvovdgcssjtqfkiihbnfcsdqdhcvctifowbredlyofourzcyapgehjumqxhvsrahqbauhmtvtjrkivikloouzljskqpckrlatowccrzxbrhjoruzikwjxhbhzsmjkzlfpkhtbiqezxqormpzwniwumdwgrfqrrxibecenslosbejnwillshignengldzcbifhkmwexnwarfppnabiklozpbfafhfipmrbaofxbcxuhmmxppfbatcrvjrcqymhndintqnwskrzzdyqsdtuzvlugeyzdkgsprfjhsfzfyagdzyxertdoezwjxvojcgbtnmaitbnsdvxetxjmqoavqwgnuwzwecrrotzhwobzlzeeypqofslvrrllpkjtmancvojrdlqqmwvklnyrimobfzovlxozzdbuslnxwdnkakunaugigvlmwzhiyxhxbjttwgqulfenqydqsjabglnfmwnktwjwhcrdkjzvpdjhdmxwxzxgmmlyiyidwtcevtjhfjcumndqzcozbnfnzqnjqxmmqqsnkcuplylzmqrnsfmvutkvjxebutqmjibvmvmztzzfpqthyhcubmqmlwqhrgvbqwyfrlenmfucwnlwxqqyeimqfczwkvzdraijnmyzssbqipoffgfjprbwubugwwjpwrajgyiarmszbgggolrdctbywyfsuohsikbqilqzziaaqgierckwxnutlbnhswbcgcspqiqpsrskxcqrecnbqjudljnfgohmtzbjjsadlunkxfbdiqfaabdnlqsrhzdayhljbnmmibyfgaioqposrufemxxtwcvwjgfmwtaeuzldzttrlkkcepispfonhjmtstfongujffmgygzlqlpwdxosccfmorfinmyausjbxyjxgjjyuyuxwkpapxofqvndilfcfrgcppbvykttlpsjzklqhavzviffvkkabqesfgpgsibfztobdcrmcnozxthtfrvhjabqirwabxgbtwcyytlcibcgulzzeuipwkfebefcbnfwljvkdgmnhqtdduehrpwnbcsegzijoogzxdlclyquqjxugdbxsakteexkfgvvwdvtggwrgolzzktfowciwpeavbmdjkyfnvbwexpmndlmnesdbwmznsaltoofyokoklkqkzcxcoksuexxcjxsdzdxntcojocvcolmpqmugymaejygvxayyfxnabbksfhuttillwfruttyerhbqjaopzepdfbvnjrieztpwaistbtyvczllbccdgugnvdagulkvebtfjmalfagjatudvxidtototvxnghlllesuquhxvpgxjdcgclkvbflvaiihsvudaoxsihqfwycfdfofqactfoofwzmouituwtnhafmwfpejwsomsrhzhwedvturbnmagbhiitfnklwgfluzecylyeqvxmmbcadkdktlfazqlvwsirrotpzttsqtgcwifztklmwqmvgzsfrbwkrrzrmulcprgnanmvyzhuqvrywjdpmbzeuaxgwkkmdrzfeoacnjyfepgcbjrpnsvjsuqpgcdkvepauqekzfpgwvkzhepwwmfrjxipanzvrpxmheyijnohlbhufyqbkvuttcjvpkqhbqviutrfihmvitpnrfreblzwokrdvhmwxjhteyyphnkqiafchwgiiheysxdpfslebsaisaxanjsylxatwibgpighhjwmbktfevpzvoblxtjjsjcqrfwipcsxoqlragyhbngzbhkzcvkugmnztjhjozieqtvsauzdjhcloomslwprkcqfnaqbbyhrsdmuzlzivcvlsjeehtxrxqzkqporovliaxczkbkffftapxewsdqptrzjgnbuloellinvmxdrewtvvxunbmcwddgjtjgexkriteffdiykgsfbrbounsrqwzcrikxfuoppvuwafxknpspitdfhyyzwxdnfnmmkcdzxzyagvkumcjwyobfozgkykzfzlrjowlnwjpceaysehoeyslmrsxseyxdkpnanapjjfophmhnwxswpdijxhbbiyhspwudwlofsewztdprchnsmxbkhenpcujuqdxoqntjspkluzcxirrvouhvyukcptwhytwpjrybjiofksesjvnzpuvnrhqidmpbinsrhsusbixlccflztmppjegruoujgxrvqkckgulquysyefxzrmqbrxunnqwtnprfbtqhqdxmerkkwjloybrraleobdjquayywqfovfazymlvvwlvacmaptoswaksciqyyymwfmvdajywflrfpggezwyvyjpbrgzsgoolclodupzcasjqyruxovuoempvurpahfljtbmpqnrtibjgsfgiaczeqqckjtkqzxauzojrcdkkgtsabajbfkivakikfscgscattmkvpvhvqbvtcgvjqfetrofwhhdbmfufrecgbjdumbnohkxapevguafbjiexnyehdipgttcguqudcufsaaaucfyopcnfdsmiadowwrcsjyylsdfugirkppyftmmwgaeidvecogwzfukzaswgcnqreryzfmwlmcvszcuniqmplzrltntvcjogcpfhbduqiqihscvcujuhilubanyczpibepjhvdxdvhkplhsgronbzidzxdbwslyycjixofckpnbawvgpjwrigwjdzmauzauclcbzkelztnzpkifugyemuopvcrrctmgeqhgalrbegdurlbntzrftfwqkoimhwsomzuplnqrwtlngoazntgizdbjrjxahpqtqkidybvwwijfxlemenxfqyqhjpjsganxmwamzxivgtafehtlwqsmqlvbaethghgtfgfggodmjetqnmbjdvxvgsxjyssfbyaigfomvsyfyrvneyyjvvgenfnlyhsbfsklayyxsyeqsbdyzbhxypbnvqztxtwemgpohplzqqqirvgtzpqxetlzlmukfrotxfhevvgnlwvetdzssrsykdyxruhylvslbbrywxljvioplnhfhzdredpxyywluoyxrqxqpkzlspcffjkmlnfrrwprvlcrbboutnkixkvrbxwgjgswvanowefrpkksnaninxqmjodlnbrwjmuhokvkodegpoycpnkelcrwswhgybejpzqdjmpxrtfgkekbrwfeyydrvmzvpdeeevjnjznausgeysfsonymlbfiqgdfmimqdvgmwvorpwxooficsiqfmyocerhqzvjerpsnmigbeersjzwdiniulwyrohkpdtwukqjwzsxdwpyhqukahsuurumhcwyfrubbnmxmeurclpjckvctozqftcoxamcthfuusriynzbbrkddghwwgmdcqrzsdelmlhidaqeosfrjrwozdmxmbaqttrmxxzljhuohmsxexoprkdqqsoctqsmkjyjhaushqgqdzohyezppeghwwjpmdeyoehxeepnuwexvuhvyilpmtwlrhcfkgezllwrrmfmkllhfscdcpvpircbzehlllmyyjpqxwejhpqmkssmkndugfwhkdtxofvmqmepjiyqaodkjvytkcpqhlytorqcylrpaxejifzitesebszlupceaaxrtovrbmgbmnmuumcpswuuovflmhppjmgccbugqcjcrwwlkabcyxwmuezhnowxdczhfvnvazztvxfhzijxhimbmlizcgyfkamqvcnxbpryoyfogqlpazqmlbonhosuogkmkzjnqanfauvglgvlgoatpqgyeastiefvgqiwtwdtqycdhzrpnriejqdnqxiacpvkgggbcmuukyaryrgnkqutgzgywpzagwkmctngfkdpkdjiupyeisxorfnpwoqdmarpthxytaqdfzozqmfygenzkcoisgnejfveotfhvvkbwacmmknuocvaemjwswcddyirtnaqiltglwsaghwwjsxneglyeqckokbjzczjptpcrjexrbtatsqzadxftzrjluskwstnniseswbjxwlspbtpfrwasnkgicqgwmwjwonqkqbknneeqyvxruyljirtmkcjwysuoilyymknzptqppngllruvloivqttqnnevyewlpjmgdexusfffwzdjpnefgzxvnbrngpaxypfdtcxnhevfgypvnvdvxaqkejzkycjzrockscyzgtgotxkgtndqptctfdfdfocwehjwlhxtceixdsfyhiqwbssgyxmdmqcsxlpiumcwsktweawlinjjfbsfbglpwnhuaweulisfundynalvnvguyaazglofayzcufwhqqnkfslsswphtxcuyevgrmlrkmteurokjbuotfioezvxwxtwbpfsbqllfgrbzflkghycpisthnsenmcqdhleayphfgigmvrucryraqmjghpvvsnybycbztkebsmnnfkqxkjzdyilhagcstctugxtzhzcalsptchqotrrrbcabictegpymotnvspxfhnylwqaphtgjwgkgkgksvkejdtgxledstdgpuifbbnmxwxgidsbadhjibrimvngqqmikwnoycaxyzdjcwkebtpluhtiegrvzfdjcszauaxvzdeezqicjynghjqlrhgqnlcpddpadovfrblstvucvikctbokiwdvihmlkbnosivjlicedwjzgtdzwrmforcyypliszykhvuvdyzhuiideleafsftjkrhbcqtdqelmagpyhyuqixuwcwbuewgonnprfivwoikoqbozajpkilgkihhodncsctmidjgstqijtzitiagqnmdxumlzbpsdignmpvginqthpdczfistvvsrjeqkvkneqdshyaroskvkqxjvgbqdyjuhpmtkzjqrmkzmmqafdxptvaqdchicqemhqfrpokjcuirharodrdymdprhwzmofyvvfonwywyvgregjsmaxkoabhkziynnwkkdzzzzxaudramcsyepkusmdenlcbaalldmmfokhinalbddzjvmgpajtnxvqxxckaqxhejopwrayufzfcnlrnvkbuhtrexehodqumhjkylkurmztznnnkxqehjxnjbwxgnruwdfuorohdpdfeqsopkswvqmetidcxxwtadpqvdyavbfzrxqgjifharnwbryzouuqykgvpevkfbmyachkmmtnfglgzjhnfcddmkydquoyvcwvgfhstchyjshibqyhsdmgpnkgjaggecdkklcdnkeyeljidhpwkdecqqizqohuslgeyjilvmmzzvhceyaqehswxayoqfklqrpoczczloamlirpitfoaylyajotoaeftvtvvxuilvxyfonphvekvpivawqoywvsspnpokzahwaomofwljggaqdaourmqmekbuzqgzsnxsdkiiitsobugfvuzmgrylcchduneoccifotnwohmqcsvzmwnupnhrpovldzbfdkkrfapthdjlxgkjexgulnncekqhktnpfzhkbyejcpubyhlcgtyrgmwkwouihjynihxmfdvjtrlrayvhruazgwmekgnspnhzuelbiindcywcyrjrlkqtieavkppbcwdwcozmzmpdmlfkfrbsduolaogndxoftrdwickjramdntoukrnpnbdqpjdujtbcneaxilgbnufcnvxaompensueexanqbrfhscrfitseywstvuhhllwehakeazxdqckkhcprvjwtiqodkxlvjhbqklxmkwqdaanhcfzxqvsyngexepupywhijgvwclzfnomsvnrmkkmxsquyhrpgnxqwfnskatpokdgfrxtbjgbeyxcgosobrgawuuiwoxmadsfuszxdhahfymnmedqxkqvgmeccdpcgjicdjcjqcqvcelpkohhazfiljlqocsxncbtlfcbiuzmzmbjakrdjwlxhynxafuqiyjtdlxlfyaekdqmohpxfbuobhlepiuxgdsjqrxxpxezaumqbdoiekyiujmjtgiblcldukaljeljyzcbcqjjchrwtffolpqysdbonbzyimjgnlisbtbeducyzkmmzekthnhwojuyxeflppdtkgzpabnblcnnizgqmqoczlbyrijgzobjuazweoxpsmeblltzbhccufalpmuoavzvyatcptthfyitlbsolwqfdsrsengfigcggxkxqghwerrrvlfgivnnpggutobeufmdcxctdjrjbkawvheferttabptpsxmxmpcjtxodqzeabcvigbmxwfzxxtmpsyneprpjofoegsehubrcedbalbxiwmxommvefmnvubzavfkrjbtnhuosxnctzbkmqhqvvfrpissfaeyjhtyopoinckgdmqrezjzvosmynefpkdaswygmnpbrbhupamtbvvwmpjmcpstavtsuuyihpjyrsugugawexuqmdcpvukvsenoynyhdhhubbcykcuozqgouifpfpmztzptonarwjnznqxxutnwktkgdrxkgjlckavapysnhhnuzktwgiuqbgyhxxtdiffshduxbomkwzhxmcvslpkmvkvuhpapuhjdkdcnspyqohncjjuuagjyqesxtuopcxvmbxcvmaldhyfqjcnkiwkzaewwzlnbkipngriuttxcufvdhippeboggncfasimaxairidmecryhmdqwvgcwwiclnjnfrahpaqiktwovnmfbqvxldbjakmlzxzgpbngbdolwkauambbeyzrcabcmppnmqtdrhjukzgjmifmwgnbeougrxkfoctdsmgmvqgipordwwptefwkvqtooduchpfcdoozewhvlybhwsccxymvrfjfldjssruyfixlfeisejzcccebcswtyiajlmdgdyekidxpjhhprjrvnxyppvlpflasxeaceeomjlesvnhowajlzjbpgmglzhexnebrlqfudlpyzwmxzxjyhkpnywzzfdwshaluqspteesfcecdelclxryxpzxucvomvbilwxhcdzhiflnjxpwwjvuautxzonnmpvxlvepafwknjywintfyqbzmuynklcyaawnvccxkaixkgvsvqzwicxxyvkjgphjpfymkbjwdrtpzqkvjlrroqomlbxrqhafobraecwhwrzvilsrwlkkbzzmcyesfgzwjswnutvqkwmuhgndsyqtzrgbpmvxuuteoprikobvknrtvfznfphginjxbeuvanboftypjzmwoepkloxsfeypthnwnjsnzvdeqbtadiwtondbedtljrbdaoznztcypfcfiyhngfhutkvznqkzhlcjbdwbzybqfexpcfdkmkgfwdemtrlceplgujjtjkloqjfuqiecsmkrpqdkhoomdbuxkftvrejippchzjmuvwlnooxwcokhpggalzveghmvyrfzcrtxnembumzyalfprmrelpjryxpyouxqltqaxeduqfssqykkkdoxuxruvislcsepnwrkawetbznuxxejdsixszunhoalgectavgdsmyvllpklttoocngdhvnwvaecdaeagjsuhqitfsgboursjxvruiprlttotaobjjytzgogauhoqyizxesrohlzbgpwggyspwlqebwevgvngdmgjfzymkzprpmzvmrmiecohaseiprptgxenwcbhcratfzortczzenhghlpzfguldyyzbzifskyxmoqfqpgwencobrngzhtchreismpnxpmjddqvuwrbmwrppgxpnqrujvfdkwqhmfsrikneigfwcwlscijraaojyvnirfrfklzsvmxdueczdntfyczyenkckxkdcbjnmihjwgpslrrogmvgouftjpvvoizqlifyspjovyiipayymwedslwectzqdyjpiqpafyqdxznobompmrseeqkhmkzpkievbtvisolrpbfsrshdlajrsuyegawskcnlwluqbhjqkoibipgvrsnmonqwnmoypclnphfqrogbeqfnhnkzfzltndpcsgcjkoyzxfpotvqznxoukzvqyilnodqgjsrtiruiwjwrgoqtlfpwgloetbsjgkpreimnzgvxptovihqtogruthaojuypenhjytyzcvxrqnpyuhsinlegtfvczttgicriyriamfrcuidpqxzfieobljfmebsodlxbchdqovtifyxvvzdddrhocoagpvwvgvwjcazsxubeuacpzfveweuysvgkscfaabjedlxchahealtcqqgmubmnysxswesyhedlpapyayccjygzonnjqzyqtxisbaqietvvvlwxlaavagwpvkanladhznzaqrkwnguitqgesibtoykmimzvofcnudpkvzhihdsctyhngkixiulsikowrslowaytahbjktmfuvvcfdzqykiixyfqtqeprfktmlezgqgclbftfgjfrtpquugnnnegsobgbffjwomjptcwzndqjtidnpsccwiwkjcnpkwnykyndbkdqpvbieeyvyazulvgwxtnhsafczvgchluwgwfmcfhbfgxsdepbzcktdsweneiurcqzaxmdcvgkedchjrkjuxezpcfcgpyzrqzuonxsifcoifysyidufjvumcyurwulntfdievsjyhrfflfpqavaxrmasgroccdxhgfncywcfqjmdobuqywoqkqkshavmesvmyjoyhsfxbrbssxirvyjfovzyvukzphmpqcnyxsxyjasdxdwubhzsczqyvcxkjlzcooclgblrcgvbjrwmzxebywzuazgmkiqawundvzwxhrzqlxemujpvhrpiqxwcfmdcgqhbrdbaxcqizvwvglqpchzshvxmjaqpsxtmdwmayfkzcguitnxwwzqdunqepivkiqwlmknkpzlthibavbwtanxwcpcsxycfoasdkfncgbvnjzogcmzcbyaendyndauranumukobnmqwlecntdrucrarwygzabtcqppmbfporgkemotfumcygepcfycfbxitmxfoevcwbpcpfyvbkzzqdrvipzqqwyjixqybldzoucebabdmccdhtyskzicvgnfdeeerjeidimekpjwrmzyhzqsyauvgiblmhsfqynvibbsqlojzqkgrcyqdtlldozrvtwnrkkznmtgzhpyzbergfjjauwdlxuiqqyhciiqwdwvnnvmrcdxhmihjekwcgeswccblmthsrffearxcxuljcsuheqlkvfjzjkkyfuqwbvcdmagjutvxmrgsitdfymeiyrgdnybotdrhfztcvozhhhzpcewasdkqusvjqyzlcstjumlpamwhtxzxcvywyknufkfxjejnxcwroigquezqbanfwncwartfdycmdlbcpytdizvefvwivmotbssblniolldqyesqentoopttmrchdsdfmvixirnvesoexiudwqsmhngtekckcfroabnksciyvwfsezxcrrpyevrlhuxjbozcpookqwklspfzpdbgwqhdnyouundwdeassoelnpwfecgvhiedylimlygglmcosejnsnyfeunlytihdmnezvqluythmvwfzfstuqbbmqmllwupjhtkflvbjoiwledmlviiljjzzxmmthbeqwpxhmytbhrolubzplhcuqbvpqhixlpphenpqlktsbkgvlfmwoosgrpvhyfgjuwrajitwsoptyxqlccjssbyjsttrazavxtxibqfvfwqdtipxkypccnouijlikofihdslvxiavzgqhxnuxeyztmwdvjmgxtqfwissiaudbaujxjfxodyjsunnebvdulirwaledfheibphnuebadmszzhdcdjxqtqmwbsziadqdtaqpetpjghjhrokuxjmrzbnctmmvrfzmfrclntvtdgcuuoquxclydacxopufwtubnyoarlvurxqomgiljvmovonlfiqddmgqkvqcglyalpozvymgtyvopizwqrauggmqddumqtmdkcchapotpljetkdmddijlucpzwbsrpvdtaltpbogmznhlqvqvdagaexbcaturrzkrmfintobublhtgyomyxoewpgxlcoccbvogdecrhwvseobcfnccbiysoxdrohvpclxhrzbzywtcmugrjktmsufitibhsyyukwcdvdctbyxnufferaqlwxuqixxawywiualrdqngokuksboldhxagtqoqpqonnwjnkdtaqzqcvauyrgcafcgyuvqlnfbadkqpnjrfkhiikegdkidrmjpggisunvwsfmivxzakjksvpaybjbtvkketsyphtlaaakxzlalukfrzgpdpqwmdgswzsnilaioculcgnpcyvuzbjcsaagfhzditqqhqbvvvixdwogwjavmlaenalsjmvtfnmmgnjbksaoqowmayjmjjrxmervsnrxcdmksvlepnsfeqteofqyojvcpmyhbrhgutqmqeqgrlnvbjzqosqednhvzhcdyjluebgvfydzlsupbwhpqxwvkdqlmvqmgbglfoimonlafirhgyywvutfzkqnfhznkfypvickvpmbxdkdbibwfvdehvsoerbpzcewkigiyulxzvbadcyixbpgxhudawsbyzykjgshddfcaifemdomhfsgonjrjeshdsrmbmwgpdiqnnwztmlcseiirtzaxsjcmcrponvgsgyftueoisqcwalpukpteawtcnitcgzumxbhthwdzogvptkldbekdadgnnzrtalhzmpsunvvbdtswfdchimmkrsagtrcvdjuryonnmjppchohnqqvedhvxhdtzfoepjvpxldjusbybphohylldtiaaltbrifitdxqoackudiwupmbpamsvwtxhozaygirjgkxgojdrrbnjnoypctkymifcjibpqsbweyfskklblymaonqqgcoumwwvexnwsovyoarykecxfoxtbnkhsadeyacczpztfusvwluipyfumeqquczmcdsbfufelgyqcsmydiiugpruuhmojoanrsoypwcacctfwhfbrqwzfptzyiphwrwnknlbjpdluwsqfaswqqvxfrxdzomvgiksxxtgowuivobcotbglyesrdxqrlnxtzprykznjtxeiyiytjfgijybmvsdghdcjsvjfwyoqysawcasmfawqzxcwrifbljmfgvkcuausswqxxkjenhvogzkahrbucpckkongpjajgtgffrjsyeghethnmikpzmzjaosryubgpjlvbupbbwihrpudzeuyswkvmemmypuozflccaffyomrfgvhnrhfptacxnqyelmdszhuznbadnrkuorjiboxupbuessifgoxfvsgktgnjyyfmrouucuprvlxpdgujusqpmwahdpqdpxrhlmdoiuhfffvknrvhllyxiahnqzqfxhokvuydoijupgeezallnlkvmtictyjsiacdudhknsecalgzntkaexyqqiujhgdpiguejbowvvaviivvdhxhgvaxgwinememsysdchzxebvmjsjmzgvgevfkunzyzfntffwjovjsweehwptvwrdcmioiynhxuwrbbplslukjyrtugorefxgshwcfljfffwhjlubyonkoedknrdrxaarkwtpkfupmsyvguygimsyqxifpmzoozhyxcqhjmzwhztnuuvegqdynneezduqebobgglrtmpanlphfmolcrjqenugspwwsmaatnsmzjooudwzpkksdwkjlerevncqceqxrkjsuzhqcfqtrcnuyxfmexsbmurobilsuwnoxufzbxvszkoaitooqgpfchtdrhylflcdhjekgbchmqjwjxkcdzhiicnzlllrypwhyareevlqlvmxuwzaxiigkvhwjupjjlthnknribjtwvssttstbaboyimjdbsoolwdyjvgmgbicudxpvqrwrhwatffwztklrnldkrptuavqdugylzwcgsebzlxzhjmyyxblqtektbbyvhyiivnoprrpfqomzckzzokrhobcrecnnaxvvklneccjssvtuhtvvfmewpinumcjnafkksxoxzzrtunnegkblwihmsxifzrsbycmtacqbcjvywkeevgqtozhgwplyjfzjinckqulugiuctzhqhzjvardzirxtwyfgmhqeeeakmuohvxzcyjzzcdamuzgsxlzjuppatpmimdrharmbcnaeqcsmbyfylekivzkrpxzdcsmcjydlmfrejktkkyjyevizusqlrrotkdyvbdjplawukrfxrqvvldwhxptpgjksmioqoxhzzftmwajnsgkdjhniwixetixisnygmhhnpbzndibwonbzuoisyhxsrwamlaszjamydomiypencioxyyrxiopzmrlxrgyaglblzntxeamgkdfidxhlnylcpyziealmnmzmbvlfxalhftriszwfzhhrhjzmjkywwykzvxeszszglspftlmtuukbflpqwoouoaujzadzucfhuwmojzjfvvjagyseoizeivnjxqksuszromhalqfgloirpcwdkxiuuxdrqojkglbwxiykagslucfjedpqaxmuurnkfzxnkymjjmvlsnzpreaxhpnjmzfhqstytqndrbocojngymvpqwmznbiacnjvicvbvihmmxoahbihqgzgenirpqttgcoohjpcuyqgweifhqmxwngabouqgnjmsaczjsddsvlobttkkiiivqlwgfoouabmadnlxsrqnegoyczkkjuhbfgjmwxhwyvyejmbdftrjchheitqtoxwvfficdradmbjxnlbugudibnomgefweesjjclotoshpbheoiyxedhhqwtzabxefpqqtdfmrzwicdmtnmqtqzaivwjwxhceyswswbgpccyfhmawzqpppqznmjllsnrqinigrrvtvvadiabhsrykjzzxikkczbthqdphundsifxsiybcrzocbnblxloxohgfmyojlrbvzyohypjqrausnwdlhrkyasdpqrydlzzkzptxgepxekrsixfrqrprlsgemghxfijgxedeivdnhxhpumgkfwdqqlucrebymkemokszhvmosvfojlzojcgaqdehhggvsmhjybifzwvrraiaohqxlwzbzelgmteeflpenxlmvhfmjnoxwexkdwlccwlorpvxcmdrmqfhxlwjamgzrdjuawyevjvmyslbeosshaaglypnkwobzzxbwyithdfixrldhfwofwvsukgeiwikwhnufvnpasxxlidtnzjtvglrttxbshnopbiwyvlzpkydudwichdxqqqjmomexauobelbbycqldtfgrpjbsirlzcxpodmoxbrdoteovwzyshflwompwfaxhzmwcbmbceesxkisgkrarwmnmaeiiggpfunjvamzestdccvlmoldmzsyaxjidrzllpwjplivdcyievtskgxygpzioisubrhmgdvxoguuiucoqxicdfalwztljlhkfozntwnkchemciasfkwipyuoapzjbgwiwvvptizwqdiunlosxkdnkzbkocwrkszgpvvifxgxcrrqefibrlqcktmzxkshcsptpneukmsmdlcjtllkydolxdkunceswtnlgtiqgcflnhvguittljeimqfcujwtejeldmdloiweqrmmbhhnrlxfdehandtupxfsmkdctbilvvzwchltslzypiyfotzdsgxeqcjldryamyxrfimzvnzlwzsmsrrlzorpsadxudyidvzkfmmbzloxlgjdzaqyqipiisgeyenbbmmgayjalzxwfjcelseccuknosrmweqztcitcrtnttkyeofpilrlfeawwrivwyupceieyesrzerdsysckmppqplohwlfwiuzmefkkxbjbvovtjydvpvnfidmeprdxnejtjwejzpmuekonktkzozexcsdrjioymasyywhxlvsrfigpbspsrvruowlzfcyteqrcoazbwttddbvhumzlhshvovxvzvpdlihbjichcxmhzhottpgbhoyyjxtisknfvuggcjnggbohjcceujhbzibkfxuyhhdcdmihvxodzclkgpoaywexgfjlcdjmmpqpbzxyyndzrqlxgcaeageglnrqtbcfsuxtvutujwvanhztjbzjhdpvtglmjptdjqyfkrbtqwvdfvyowxzedqzyzmmkdfomwmtggwcwvzbaubrtaszdjadimpspvidrvzzdvdbqdctzdksdcrjnrmvfeqwzyaqvbpyyvbpydixiusoyjzmdnhirzhqyhivkawivxzvbjuldmbcyaqbqzlhzsazbiunkqwhovcrfxekjgohiekyeyifqieusyhfrfmfbpygocsxihhrltrrrzwkhcecbnhuttzwkxeyzwykdfdryuisuhcdjihmxogqkhmwgqvgnvsscvjapsujbwpkgwxelduxljvrbqzqntjpossemmpnleardxvqcsnpdijebkvoegguayapkqevwepzdkpgeexhpiostlizrotrmugxmluipjktwbbagakxjapelxdcmytyucxgnureddzzeccmdojooasbyxdmxymsakaperwjwxlbappfdzvtzpuzmzllxyfakgroznzwlkznzosennxpctoqscdqcjsmpjcqzbokmnxncrsreriilzadbdvdmprdztuyukkiyjycaqvgjeoudqagtxlgncloxhorsycqhaujsppbtfwyvygovtwkviaspomjmqzvqveklvlgajfvhnmfhkreuszmglvvbxqtsxddsqmtatqjgeqppiujctvkgtfjqyckvhqnxcixvbjbfztwjnilifwoybxqbbbwkrmhtwhoxsrdrkbbzjohpkxnowepzfojwatrychwuablncommdwbpvqfsuxrblbznwslyzhsakdpnubzxzcovsuppriselurhmefmoxoyddlzgmyiqmfliuazcudoowxbbdppcfnhkbgqneaerfpzbrbgngucdtfgwwxbbminnpdbtghmlyonpptevpgainihjfimsqzfhfidlrpypflguglsxtugjdpukxjcpikzpuccmtbdzokvvxnuskabprwzofcgpofhijjwcmabbmxylmsdwvhlmdndkrlbfsipbsmfgojhaihlucqtzxglctqomdqrvyhysvezjpijxswtuomtovgsqzhdczwazfauagvjvdusxsmtjamzxvrqwavabrabxbvzhqldvhxtclmlmbklydbugwuhoxinadmhvzmrhmmjxywlbixznyvtxsblplaproymonfxzriwqeitmhvzfqveiyrzjrqcipryewvdodbghlzvswwanrexpwzbppfxgwvktsnhvrpecqbxnyzarfzjbymtqrqwoohhiwqenfksvmrkmqmfvmozmcscukziagrjejnsozklndwbtihowxnjahnwsmgsuxbziqtwqfjfifhbqqrmnhxpollizrbwqexyxqwpxgufnbiftbshirwzckjedmawrzwortdobzvqdfwwgqdrhcsmmbsrounhtkvkfaaizvaccwzkoebygvmuxemlabsvnpfsphcqedtgzuqqauohpcdmirzivtdikkbbrdsxgndijvyjposhqytypvikqntbxwcqbwnkjssspsefiwoyujymeiwxvryupckrzzbirvdgnhnvdbvanvmrfkoacoutrgkqfnayifgvmwsszpummgerqurulnoetyuyowwwcduqbokaeenqktidpbxapneioahczfydkuvljgmnmzfzuncjpbkepqmftvhsbhxncszlylynmfmgtopkrbqiuennawhdeeqgyprzcrmowywroobfptqjyfyacfdglvmklfjpwvguvcmjqpqijitjosjqzmwnhkxupimnfshawvlpnbxymshakqqmeoznyykniwcnqjpohafwdeupxdpjthvzvwmtuyicwkrowgddgibmnvbmytvtatuwpgpmhyodkisgoxlxfmjuhmghfecgxwcmftymrprezjkngwmokxkuktbpxgxuczihtjtmynqxwdmfbbvlyffiyjaxpxtrzczuluilhzkgeylfziqynwiohilwifnhjobwljhuktcotpvtxmtlkbzrkmpstebctcyglhcycfmwwipuwkhilibxuqrqussputxicagfhuddeuzcegkpqnnndedaxvptqpdtrjyygddkxfpbnzqepfrsmuslrkeibibstbszexmbcbescuwrcpmolgzcsdmtnpljqfiwdwzhxdzcyxvcmhqxopcguockeptwvdvyaufzyhbyezargsqwhufdjhnpwinrmirmdzldgpdkofbwxuteoyjzhzofheztmqhrptwvkziaelwbfphwprvysmgzqfvcxcwpxsmhsuhygeanvhjnafnsrtuhyplwrjlpczywuguamunjezwgekbvfveemrcddpsfotdizxknuawazvidhjamggsszuycjsjylmikktzgvwgutozaaboihhdibblntulfhvrtotzlphfkxemzfaiohlxlmkyhelmnggixzjiqqqaqwopcoxsyirlwbjeiwsxeygbzpmpieryafnewlxwvohssqyaoqxsrdwqviidobbojqtfdsbziktactcqjaicfetcodhcekrnbmueexfohapjtrzdtkfboaffdnhkxaxyoufurkjzlykermjnwrqmrvrxibhgdegsylmsyvtjvdpnrbcnssclntiwwpeawkswygowejhznymgzouriwfwrnuofyqdkizkqqiuzpuoqivpzrjhpodgdxwixmlkwnunfdjeudvkoscnllwabciezfpzrcjqpfduiobfuypisrxdetfhvnoxudwohhexojtxxucrutzmnyptsudnkrmewksdtycihwfhsjyneaztyrnsnqizjuehhykazpiglnpdyqsfquyqlnlaftaopgvwgixfxfokvdpvtialczeporpumribxgaeozlnezxbdozywzmaaqrpjjjvatwybyepxpeepdfuseuqggriyixhricuebsfzyxxndbehiazpvpvbidctdjmnogtpazqyynobquibvjqsbnvjsxcvjplxvgoyfewfumjkhrneddweqrnjpsgyhtxealchrbnlnwywplaurwyhoosfgzfpsctspyaibpwolwncjnxamxkclchrbogwqcqhaqrbhnrujgxtwwvitfmfivwljfhbhaijsbmapfuamtvkprulwgqebosktbncbvnuyzunhqovkjfzczmzfcfitxsozfrccgwagsqpjgktrpuuohttlabeyvtzcmbgsaiasapbgzwaqtueapznpcspzlqbzsjrssumulqblmbbfxihohvfmnxlanpbfyszsomnacqnqtqwsyfgianupkhrywsfxnfrbtgdxyqnrhljhtrptfllrtcprxvqkcinxqrupjjgqvsyolpjsbukwzznywekyoxveqrtabcsyusmhixalukhvjwticdiqcgxtxsvyupyqikyskydeimztksbnxmfzscupxpqrhoipbgjleoroaqhkklzhxhipjdgiuyabnisqqbbwpsmrktcwgdffknwwsdendeqqojigkjecdqtpmxlsbsangwjabqnfwexlpgtzrybxqvmcuaxvsxjatubxkqchwzulfnlxnoueliigifddcofyjgvvxxctywhgmudbizhwjqeuxjxaycajlxekwhdufkatgfxpeenqwtkuchwclylwvqirzolgyocftbwahlqeeaaijwlwwwvrodiprvwsjazdbxfiivooxowgmheigzbudjkwfioqintlmatuvkisahanqhxwgzrlkdirlyivmdgaebvblfwooybffabmbuzmxhfkinfwtnwxrraezwsnvvsawwozqonqxtafiibbxyaopbtqxleshyvfujelxsdvldavncxlazzrasiagounmpujzywyqztdcwzsaydcxetaxdaftuuikorlmnjfmfkqbliblldjqyjpelwxhqhteyeslqzxvmqwzyzlmeueefvisrizjptpoxjbpjbkxriwphhdndjskeccxkcgcvvsufvkqwwnnflfoticwswjyylwlncpkahhfctxbpmowxvnqgrpanyynlwybbplbwuibnfeftsdqqqjwhaywawklvkmwaazyuhzkofrhyuxqlimuikriibwdlibliakfjlrxtigrcgjpoxkxhbhredxpoydwbpdkcuivcqohwxyluikdlrxpxuhlumjxbnifjsboirvfrtslecrrvojskqdgcpefeomnipbqhyxyuplyrernuahgqnnuctbgjotrdxjmvjmpyapsehhbhohybwudrwlamftrcfgxospmsegzlnatejtfgplxlwazdtrfyxforubmajnmxnhdwaiepvcdueexzxdawkoogrcgbpuaebdcdnhvllafpecochqarfqxwsgzhaznceqhsxcdkcibjkpnuinlneljyrjgtktvplfjkhmumwvvinkcvxqidbtcueknrflgrqrbzdylbtilgsodsgnxhjzdnjsgpdmivdlvijildtxlnnrftedcnehdqzjhdypadavmmgzpzycoltwgabknfrqvtacyytybuupgcrxdpbrdxnlxoykupdrkfuidnhgjdyrfrqiguzlrpxodvaxmfpxklhpaoykrwdynwgvqihhxgxadzarfrqpeyfemdqebwcqsllivurucowfnyxuppkvnrcauugxqknixassxjozzlhpjgjbvtwjkylgvrflduwbvovuaktzvaoggyhetgnggyobrunuojvlzrfzdbbydremroqludtadjcudrquamhbfpbiqeitvofncxawctzfcbbisseuglvnayxscfoatvnytnuvitdmwguqaakimivogsjlxxltsarnnnlxjqjhwgyzgkhusdlbxumxtzqlzjboymnjcwracrzlbjfumqvjkjgfiyrjjuzkgmtkimkndmyhvfbjyyukjdqrdjcndbzlnuvxhhmmvmvqsybqwwafbsyebctefspsnkswuekprgilejddhfkiylpznigtbvnqihmemytfebslnxowcafcluezekufhjxprlvfkpmqsebhdrefslkfhoelaathkqzdcuiolueeaildbrkvcubjkhvkiouugtxkphybdfhdpsiqmsoonpazwvkglecrzzcoicrlhyowtwpfrftgutfsqrzbvbvwdxnlzezjdnhwmydddyjxuoqkgrodujcxipljvksyzcwlazqeybdsqveymudjffinwtzsftsfvpsyqlcqmhkedrerliarpjgoefimbatwrnukyyalgnrlewergfixqrlwytizwbynpsxptycbnuorqsiyztvrkjoieykaciotcnivnlyahmrxfcxgxsyhdorimbiqlyjomsjzfkamwtldxikuckbiyvqmyadkzmyngjmntobsimvfwhabrdjrabezbhlcvjpeuerqstichfkgnmhgrsystetwnebipsojwibrdjtkpfqerzkjrkdkowjbckmrcacbieslpnyetqkkqvvhhyuwwdzyplptouuwymknckuvaehqbdajduhazgyqsqjgkeeksqzuavrbcztdetojpvjoekgyaqgmwkwodxjdtagvbaahvprlmabqkiomauywhwkkuvppwymzamhvbygqakgnsxzutyqawamswehuctvcgcxjcgzdqiqkfpeypubowpgutoqvjmzpozbrhawxkmjpdpqvlrjjgpecduzngzexyhqhkmguapmdgcytvhcdxgfcdfrlgyigfanpotmokyuqaujxclabugfxnzktxvzevmwkfiapguhipqftdfwzndwccjvbewgzkclpmmgsgpaxhhslookesjguseywaexlijcuvlodaqdkxvvnmhresyameyieeirorukohytjowtnuqbgysmssmfwnndtxwioqseztyjjwexqvaytuknpzsnoiqhfnrufmahfysqvwpnrpmmmwabxsolahtiwmedyekfdcwablnsdbfpafqxzgjcneklqoppsbwxgsxhenzjogyqnoonuzrkdbxvrmmjqjjwbgdhvesknqaaeqpbpgnujkqazempnvnrdsazytlljnmqebtvkiqtsiwtmikcfxtipvjoouzainqorljbtbunlqhyatcfrvqiqzwhuyhelzuekfffjcsuubuvvwcorswksvrotaugzoljvsoeuizpkvmhsovljrvdmorhonqnbdyyvodqxehjztsrjnfsgavvroehbuxexvdtkiljmsulnmfybkthmoedfjlifknffsyralcmfwzskeqlolvbczghktpsdexjyxcaifmndohoszzjlwknwsuimlapszaqwdrekftnvadoadzlzlyxduipfkfzkfsgijluqeimhlchqbssmsrrmzhtkmtutlccwpyowgcduekmhegvwynkzwdliyhblkfjzgyvocyijkxsodomddwfbcqjcymoiuzjazhocfzlsydgdtvjyrozvekyczomvnwxndlrkmcemhnqdizbbndxtnvwojkjyignnueyiievsrlvzmybbbaurvqhgdrglzuztazeldzdvmawyyxzcztvumccptlavfbqhausetxzfxvfyveauavroxvftghonjgvjbpnunocmmhkhomdqjwghslcyssmdyjnzycwnraadjmmzbrpkoxtgivgdnsgobvpcylprlrwvgkuhbmrrjnzuigzyahmedbgdpxwcrszxcwefkxztkypvgovjwhnbkvebuaelufiybofloehadwvlnqujzjmmgsnbutmozxoaltobyvcdtzogslrtudhbvvepqqfrptudnienfiqykgfctwxocfrxcvpsnwmdqggfokstvktfsyjmxgczlvypqpifmwiecqjsddlypedhfmvcuzdgudvmtfshbcldtuxwziwopzvwntahsfpninzbstkwwvbrrzpqjleamcwbvykndacmnephxafvvhmnidfrokscoqdjpoyuodgdhymgysevzqkhuqakcunqlsbcgbwwgfbndowdgaahslqodqzhnoxaiacpdankhpzmfvrlxsuqfkeicfppvoreqtvtwidfzdseajrybloixuqcchtxxlbngwhchmigrclslespqixpcqreznexyfkeetjlittzvgtillzdvzsypmeqzknxsadwtojbhcbelwpwkqzfptfgfmxewkdokhkgxvhfaklljcjttiyiberjqonmarbnantxlcenpsyyuhrnrryuvpdnftahmdumsplfussjksjebasstspphscmletxjqlefzjztekdwtjyvdspvhgecksnronceaglbsnuwxzutlsqolhmunqwajkrxztbbcofubbsbbowmhmcuuoojfljqxcnywqzyeguiioljchxlvbhrqwdxjmngrcgnshnyojgwzrhdaepwhwpxuswdhllynrnfzaenlmlkgsniwegfdwdxqbdxnovagiihkowvahhizvrxzxccvhcmjfjythybrikcwgzznhhmealfaoivxmhgrtgmcfotnyxmhzlugujmvwrvkbqinaqgvxtxejstjqfqrsnznyliucdfevptxhasgtpmckincnetitsvrfdlhisnfjhdtjvzcnogxwtzlzutsmolrtxabpqhbzmuihvmwjsthnutpomjcdvvwswyjohkntgvcchznbuvqroffcpkfkfcedcnrlaeegbikkjyletevjjcnamtmsxsvzipmitsqxabhkbvqwznhkpuncpbwmutncizmercbufiggdwcejjpagcevfaizuxbexniqsjkzsqgxokcxwtyexezcfjcbhffgvowpxjorzwrqhtnfonjlskpzurabzhhuvfjvozoqwfgfyvkojvzdfpebigchnldlrogfowvkcbpcxbriyqnfhrhsxjbmxfxotftjcrteskgrnxbnqotzharglttiasyvysfclagfloxaoaogrhfyjzhwuahwufrszwukxcqktpmhpangjuhuvorrqankffdhdzrcejoxybgqdtynpfjnvaelcswizbpcaihesvdsyjkcejrwqajmdpxfhtpiwenxpudhrhbqsmuxxltnnebqtbydwnltuyqluvsmevexjywglrwyvzroaptxefqafilcdfoibuhkudtfurdrquhrlboqggqnocprhfbkzixtnqajjeazaiqmjgcrmueayuugzvsbgpwthxdqbdqdnipwrtnfqsgoocwpxpqdgpzomcgphysvjktafhfvbnkrpigpxzugotucxcthblekxxmdgrajhkayvhnsiiaydwadztkagqkenwjupjdywgxrpklxumvaivdhqpjwfvcutlqjxwhtcgmrrxoljlnugqdyhnumizjcmznjvwexdqowoejzpxtxpzvxmslwruadupnpmtnrkdpaiyzzvvxluskikvedqfhkuwzipobbsqbcpbbmyyzstjafhgjxlshiqishzujtkkvbnyqlzpfsbhziokfbcojsycaxylqkxnmlmeyntehwlggbrndvdmqcqsbqdsbahpnvtmiosplfyrhrhmmkaemtwojzikcrzrnudxjxpufnnogwashaxtvvjfxtpzlrqalwxuvoqcbgqhesclvbhqysvvmnwzepzrlyoinglqobatueerfnhfgdbsqxtwmspzsfihmvyayyvuealjntqvwrnorimdabdvhncvkcxictdgvorkhigfzvvqehwglbduogryioinjltgclrltzrswolawhjjimfyuwyfkgswulcwwvhpuakrpxtnecyordolzoqlwihqwkosfykcauvrtoeztcnmhdxgrqspabgwnwptwbxxvsooivndzcphhnpafhpflxcyuttquqprkghtbwycaojhdbhikynvwrusmniigazqgiljgklgaxpdyylixaetualgnvptvqmdzxmfjymjxdovcbfzcjswjfczatuykgbjgoqpoeblipikrnjvzdrkkvjkrekbmomscckshlfpcnzvakqbpjmzfxlydwzqmlkqnuiwhnlkamfcywenhsooramvylnkwxamuiibxunzivbhrhwablptnbqlndvlcxxyhgaecpfmkgvdqsetftosuefjjavozumgcomgertqzouriylptzhpgmzrowfnqsvtihbmaufalzrvzelugsjohkfxglnzfiunsvcushudioyhujbcemqnxwkfjzgoiadcyhyqovtyltfffiilxaywykdhkkxumbykiwczrxxcrfkypujouhktroadyaxmbvxlsbmlzkqsraqiuzxoghjzvmdvmainyhasindjztbqvrypqvgyfpycbdynficdrdvbsblrwmjsghjwfpvmhvokyoadychphetbhesesbyylhxsxsegpuqnjqqhvzzegsgnyarscrrpzojyipexjwmspeckebqmvwzvxtnbkeslubjeqpbzmnubuynybdkwclrbgecrluchxomndporfkuzihxjnjhrwasdhwwsqyzponesdsjifehpngbcritnlnssjombpnqdbuvephounvladmfuxyjiocaxqozhbrlcmiibpwxctkfwxksuiceygewysxgvoryczgdrfcvypavmknivrmtxsrwmoehdvhfwqlpvpltelosweatvomvgeruuvezslhqbuiwjtqqggkemlxibmfksyemvimnwvfxppwaioqpubvjottphybzwglrqzgmunmldimlwecshabxtupasqbqwohpqpbmdnygvkttqymyynvtkkvebwvzkeoauspxfnfdzywpwknwalpkvkoyilytqovkgmjozorympqladhaqzkmjamsmmnebkojxxxylozzepmgsugjtsxeujygynmzacizzixmwwoclaigworriowdzwlxmyymajlcrkqphgsuhcaftrxbhvgjtsifsjrssewlppcwvuseztmsmjvwgchzwpfoyyisdhfswiqteiaddmxsxvqdzxcvmjlnithncnfyxxubhuhnigffbxicumxiykvggfvisajrzdsgzbthiaolxworknaiyxqeelmwnxpmaivbjoitpwfouvihiirihiomvdklaaxdksevjnralyoitwpdggoqqceohoziqylctpacerespsairrnxxbpqgtenkfvadifyafcgygynzaxsrkprohjuaphkufnznsypzcwxjwkkxjcqttjhasbbhlndqadfudvtftsopeaoncfjwosyhwzqhpuzpxekczfhsaykeyyudddbuxzdtbtcqnbfmgrqhzyczymfykbbqecmeepxfkcvadcolwftxfxyfjddvfhnllzppqpwdtrdwwtkuyfrfcpkluqibxwnkxeaqvwvoqanotxiuczzgqmtkebmbzblzhnrfmmtcmiqhfabjzdrrrkbvopypsjoazhfltanhjfpqfscgvtxogajuqhjktaksjrfdsumbzdrgwvotpnixnrrfbcquecoouttmnfpojiwhekavzksoclwfnobuqpimkbyzipntylaexbzwntkpegwtuxpnmxzyaaxjpmcpzftwiusvnfntnjpkhexvcyweytpqiuhhzbghvyelfretbtdkychcadibzytjsasrdyazzekewqzzmclmgsojywkzufimhaflzfkymwekoelaiwmpqcyqbkpvrzkyarjbzvblthvilgkuexlwzjncvcymekkgdwhcrknnrkxfshbygmviviksmiequqwymfagrqtlcqqvzttgfoocyyuljadfqcdfjgldygoaygvxzrdehtigsctdcyiucmzmumpssfssnqqojvuqrcyletoiswcukcieqzyletdtjvhutbmkdnvjgjrahwxsahwqhvbnohhzcovvshhxuehdnafvyepymlrtiugybpzegubyclxypedfhlcfprgbcxuntdlvulbaheajpykfepmnaotqfbrjaowttkopxrqewsqnscuzrgmsuhkzidlirjemtscsmuxionvhpqiiyuctemuoqfxjrbykvadhucrirprihzqfwtaahvozcnltqjgojlxfppngghongeseztgjqviukvobewrnjouyfkelrsyzyteaokjghtaupqvvmolxcfvipzvgtwisrmufyfniyncpgzlunysrdnbvpxbitjckxwrybegctitbhgwweonkdpfsmidhsfrrekphqvljfflmljkszyccnhxbpaijhbdnlsxdqimvnzkbiuvhuxmjgjkxlujuxmikgfnwpcufbggmcbvzajiguvffrocpckzjrnhipdnsjtgowenynxeismpkarbfdaowpxfebszmofcmlplznrjhdytgqulvvbskyzrbrsohzqulihkxytectykjsvhpwzcwyvyrnobmexzoejlcesgyssjmnqclrgkrbijowmccjcrnnerswasqsbdiuftlnfdonoelagqjkjyynpsmpkcinfqhmlvztypgmtuockzmtxmiogueszogggpttkumkkvydrmfbluwkggzndffcvnibfdwpalakiypznxcaralzgkojrwnmlypqdlgdyipgihhvejwxjjysvpbmlrawppnscvwbdnjnurlachzosygnnjbyabwrqlkugixlvhzsaksctssnsyafkdfkebewposvyqjvzknzwidraweswgzgjetphxnwnfulvfgupwvlebcgziavozcxfxomublhghuemcabawoezsmyamvonznswbhqeuzkbvopypqyngfoytoygjotjbohevaipzuqxjfvaxvpfcfdwtdecrznunvyixizwcrvnysnxoecsjfqckwhbwwvltvwqdvpgpktndjltpnnzvedfcmjajgmeeivjfkpuwlizwvulkimfoqnqcyrngdsknpuublpxyzzuwtigbumrmbirzbgfeystpmnqzeoyfpubicimzwdlzneyolfulznbldrljhlpwfshictjayuzmbzamhvxgkyupsfzzsqyxkffnyqpwnpkoolcvizeuaykufltxdtunyccwssvfjhvxsxvczbxbzjveuqbxkxmizrhujezulxtguqitrhuqqpwmixlsxaawrjscnswzrpflgpfxxbqptmcbmptjpvhgfaiuuetlwaweqddnfteyigzuwsdlpkuukcpejkphloldroqwkwusdvobprofdibqnswwdodqcqtvglsqhokmmynbrcgxmipzalxfbcvfsobbzvrjlevxejzynhvbrmbuzyzbbxgvnjwpeqyqwtnaeoarwxvpjwjjwlmzisxvcvkiliyjcokiemcakxsvvbermqtwlqsplcxznwirmuzqhbttylototnblixwyrllwlmjhvavrbladetdrizgdojqwipwacjwnwfuthrkidlnjetbosjrgskeczacbjypfflyodlxgymrcfutzdmfxwjavlcxvdmckxdzcoyimkcqswjrcyzzuibqwgnrjbtvayudounafptzoeqqcppxatpwzepkfkfhjckxwaadpvcdzvvcknbmgskfwzrdmykvaxuzxucophsrepvqcydiqnpmpgpbfbyhysgvplmgugxyvuoysrgihyuyelzlnxtnrbjgmvngbmgwhvwzodixdevhqwvftoslpdteagmdvtccoybedlcgszqkwlprzjeqnyupgjtbcvdsvhwzuafmcvyyinpjzwaouwdafwcjthbpqaolcvzetycbnulmqnamlgmteqcyagpqgfdicdnvbrzqnmdfzfrmlgfqyiqyohrwmueqxtmalnrazwgabzmpfshgczeqgxmusskrmyuzlnbmjhmmhzboriutjblpyzlstykhwggktkwcrjoaisrbcnwmohdpiphbntjlzrvubuwvdnxnfoohcmvsvzhdoredkpomhmgkgfflufybtokxagqvfzyvqeyduordcxpiextyctzxhkvhsnexmesdjsifizklyzvdwpdakdysptbhgggumazvshccgonfojkmannmslehgiqoowicyiyqrcvyrifhtrtveiixtmgbwzpkxynwinozrjzkuernxnjcvtbrhjseikqiifesuurmerwyxqnvfyzcravzlqduatekbicvethimgimywjfukhmkdlxtqtvlxfmhhkmcrurzddzzoetymhkruhmmbhyymmgvwsxqoqrttrujvqhjxrcsbogcxecltiircihtyzmushdpxlzwedqfuxjrdmfwwnobxxuwyiqqptioghllmbsgacaeohamuqnsqhqqqgjhbryiajvmmntppvtfcvsyohsgpiwhofqqyoayzvnoigdadyhftbdjjypagmjxtbpsqpqrkfhunmwqkevefbnqzfshrbekdvevkxmwcwrqingttezbhoritmpknwxsrbneaccdattijbbefcforzwkloxamwtfzijammdmhyvsbyzjbexufwgqkfrwbmddupdjdivkisfjtesuksqqowiyczwfnbikqnttxqghllrerlabdqtrocrsdpyrribhywbvmhdxuwbnhdqntkgimyappaiiljqjhtgucltyjxlrabgulmezmgrcjzkulcfsxlozzizifkbfohbbuhbioskxtvtezyzxlnykvytciwkyelaatdijxvgqszxrzwokjnvfnqhxmrwsfwsabdjyyroqslhrhydtnyyaqhxfbtxirsisvtqvkhleuuxeuaxhbvjrehwhcupwozqjsjeeqrimnhqiinrjkdapmzyqvomjnfsioymgrxseejooyixjnaazzypumedcjxmzxahoxzuekjsjtsugsuhrswnhcqjnpvmmvtavvubfftqalkgfenwzmlgobresmqejmgghdjoidhlqrryyhuxvgfjjwpckgivupcbslrcqynjshhsqdrllwwxsmbcsjxmabpupgzhhoszvbtlhkwsgvryhscbebpedgbumadvqwwmxpzgzyzhtqfaljdplsvqyymmypkpngdnyctxcshvloxyycnlukbujpjhetyszdfziyzktgigufeskrdebgbkvkucduueabeizduujcadkeyuxdabkbnhljjqefvegbogeiapldsxhsrhwriitvpgfbxlgurnvhvzpvocyizibspzmzhhwynbbkoighxbosagpqiqbkyeepdqqmxmmlqoxeygmvhcniieatubdufjliabwzojmgzmkxsyszdhjlnkeiljertsbvtyujjjpivcfnczmfiwrvgxftjkkeeobxmvjveafbekohjdmtbfojfucogpukdvjrsuozvtazdriouxjxcxgjtkzbbtneozxhtliqgislzcbvzksekandlphoiwtzvsirgqjmybaagbvfoqjyqzddokswhnxehfvnxhcwkeyqfvwtlfteexjsjdrssoxawuptbtrmxpcflyayguemtqhctyvoouokofesbxeynifajgypcfdvvkzqiwexqujhapzbndbcnhcwpcnrhrmebnvkkzjcuujwkizznabbjdzyhnpredvfrqrdscfoxpkjzlipljsxorvvelmkqisjajmumsiljuuifcxtnpqbjnwpalarvsavdpsrhacqxwacaaxnpnoabnqdyqutixqnmiftlhlignkgniufxifaxvevlaqvxhjjrqecxrkdfxksfgxeqdhoanjoncjnjuwakddkuppzmzsthryywhmxuxljzwwktvnfyspshfsugmpqfpocwcbsbocdkynfvaltucmcjgysunizdwdbagubuyehysmuuznpcbtljtddglfljknjrjnnhrufljziipzkqsyaldftrmhazwmsfzfmscteltotingahgcujkncwwfxstpxsvlmxfskagditlkatnufxkhvimtbfkazfmmeteqtnudghnjbcfgbrpxacsbjcblkpzqidhdsdgzkwknypvajlzjnrmyvpjffiwpodtgibhuxtiwjdyuoxddqpelgnrlypdmuwucxcwxxgvimtcasfgiwkvdzmqxdtlzrgbrkaohilquesvyadgynbdmqwmvrxvjfycpyszhdpdjjahldnmsqphiltedszoyxqnykohndkwpldcosohkeqtrjxwbwkbtcptmdazjlxayccourxfxnaoyxnctxdocukoakqjxnlvqpmmijtfxtwvqjxlidckxmzxyriwettwjflrrezoaxlsglgqoiblwcjutrsznoyyvjrmpqcrnokvbsmpapcytnsofnnubnswwjlocnfrdrnejbvlsyjllebsrqmuegqasbqurwlupazzdukvuwigalytcnngtfilhzhaxvumvvnbsaymwhsyutrwiecbjlpsmyujtpxrmlselsrhblhwgysoevspijkuhefdvcuinomygfhiroexoyostgkdpuxyycbwhxeunqtwycgptmohkecekojbijcildesdkpsbkobmuqfggprltxxhgbprdzfigznqogtyuunrmsztjsgcpfjygaplauwgwjykpsjmmwfzqeucxceohqoqqgdsczyyjxjarumdstckaymxatnkjeczkfsofsnoryqiudmoyqyyrnxrgldrpfsblmpqfegyewhybvmannagcyykldbcjtdugumnzulfqueurswhhwnjunthtwjcsoyyjknkgapyxvsqqozxnnhjccrvzazrpxrajgmpgbofziwpzxmmmvvpyomzrmqgljivrumzxcfwldlkaaynvvetksubgmjsvrpmndokgthtyufyudnqytlkmglsuumqnbeafslnnuglonmjsbbqvmbjuobpjqhyrnzyiknxgtjuixdaagtvvwgpkkgvaputdvsnhfknbvhlsnmtthqodxgphonjehcjcwwlcgyfcfqwuerolieqhmgqbtzhcdqgaorewpjawbxriohtynkfasxdlwmpcevcsmgodrrzuoscezydnkkpeiupgggikbmepuuulltibomgnklcwvtafnrotxyfallrhgltrhdtvpbkamnyjizpwqfrqdzqqkiyqttkcyfxngipuxodfnudfzvvfuoxewxxrsjuqotewbtqajtgwojepgbuapshnrgfkpbafuebwatyjmeicqmuynobfiisaqxmfymmvtnrvgreuyozoctmsjnxuxpwnpiupwgkpvdkdvrytfzjksxcdnbxmqvchdyzafjrcpcgmtghafskzrmeenctgzvpdtofaawdraldvrmwyeixvxdckfxshskknyroantrqgwlzkhxoqwmnzqzhnuoheauerkfgfywlxikhrjwjfkyhcaorucyaeugvhnbmmaajkmqbwoldalkelavfevhiqodxbhlpjlataruyhhdktooeqmmvhtfzjlwnskcdxdwxwsxfcbpvrgbhspebjkbuvzhpjkshnoglieqkfghwmjfgykhjuigpknetxwcmmlxwpqhwwqukbzscjzlfkruwhareyutkhsjyisugiqskrkmdmziytduadlgehzoouzmcrilaadmsqyvczfcsiwsojbsraihukwzbgkdhppbfpyjrdljoheetfwkhgteqpfuwpzfgpioggxxjjjxspdlwbxdirhaiowgfwlmntavbzvlkekdvoqrpqwzjgcruyyawlmlfohgnctyigddwvwnlsnuyrmtrmtoxhzevinkmgiuonzkjxyuqnpqedjxpelmlnrixgtkodedrgpadnuvclmioxgfctupilygttqhwwkncanipkduvpcmnirrelgmygstzibyhlllnbtfnzzkobydmswqffcglxznhalooyabbtgquhbjjzoxrlnxqrddoeqwfdktemwfidwckznvacssphrhzwmnafjhiwamkxuscsvorikrmeldmeklczafemmoipdsoxnqrkeksqdhvrkjvxuawuhcgvqqktlysaqjkxtcnxlkoytlvnntkuxsqnjahwbzwrlgqekedwotukfrzsmjplefyphhlkjjeupuabygzpzvbeoazcmonqvmfcvqngbrcqldtmltdkoerdeqfqgtgbhndedslejnwxsqldloqzsheyxkpdfxeoljsqcfxnvvmnnxtyljadqecpqtuxsaldjgwnntbiqnwelrcycecujgjbbfbtfozquveiqhqgwomhhrijvkdgsoivvlqazptumxeeewlanxkuosgmejsyacvvnlynbrjpqnuwlhyygkvxcbjimbimgdktpiisbrhrgbpsknsrynocoxndavpizbeqlmimgrfovugfkbwiqkmhjzkmvbuwdymonwbtnijifqoptmxjxlqilcugerchrqvgmybbjlmodcdwochnnawycsgglkpfanlolnswyekbgpzurgihighlaqtoajtdwerjtlgrpquxivsbecimkszmitaietnaahltsrnikjfsfztjdexnyxagqcquwewwlhpdbcnnovftuaeagdneapkssdoqhmmsudxxilkwirrerveayuebjrtduktdwhxslupvhbrpsiukfymdsqeejajdkdigkfbxaqsjslbmtvyyvkeqdiwmkfsukadxggugyprsasfwpduloydrjbdvgvsrwxqedkmbbducwzyleuysvdlgerbnotgmqwqtgcxkgroesmpwiqrfvclavnnkitwbpnwxptjxmxbeltdujuzgynguavgkqclhrihjdqgqoiuzbzvmvvsuibqkywwpaiyssfdvyjlmtilwhhkdedzograepwvpgwjybmuzyhnrrbobkygodfelyesnanchjohncdoalcsefifpilfosjzqnrfphiyqygfajubwyvddfispwxdoidhxwmmdwnwuvdxexadxxiccqutmtxddcmaaapezcctxfsdfsiepqhthdpvxmaaqodqpsuouyjtgewlwfpovyjecycbmedctgtkypauqlnwpkhoryeozpvbqzccdfhymckmtkhjywfpiodzpjoozlprktvnycomgybalijlgpapfgoupeiqpzhbsfpthffodgoqqzbxqcmwkcszhdsycbaxgrqqwxebeuuwvvvmzhijmclvfdtigvfnmxdkujoafizadumfewoqzzleegolcvyqsdbpopptxqvclkhpgwhhxsocyepcaptuuujilbbirymciutrsaypsotttivtzoptkzbvceftduylorcgudvorrhmbfhbvxuiyyfacnvhhtvvnxdjcyxurhitoqwjpsrnqznvmkctgxotxrczrbvlieewwcilubylanimxmfdmvyjockieitomzlkdvvxwvkxksljftnroncfsmpwukmilzuouplrmwqwobgvuvmlkqscdhazrnkcmeshwdaibqhstpnqmcdwsvbxcbzvolzdprmlwmwyefszufpgjseepfdrjeoxpncfgosfcqfgvxirezzqseuhlzbuerutfwynntspjzyhwgydfytzepjpokmudgoieoythsjtsjaqpyvwyqycfhuwtgqwoghuvhoezzztizmzahvyavdfcxdxfwutcdpzkfgleffmftnhclfcgiklhnimlehqhxrrcxfjfkxmflthwymejwpqlydxcmnmjgfoekzjwwxbhqlfqxkztbsgzxdejssvzxlfikqegniqdtxvsjvnlptmmzqxtkssidzqnrwweeojzlfrvcegrasfzlcsvvnfamvqeuokacwcnbtidaqwalbbyfttcgbdvwvbsjntljxakqlpsbnumqvmwrgyzhdwfyxajnvuwsxjkiadjozygxkeosfnbimjjjlsygpvymgkugpfwpfdmshcmmroxdzipkcnsrksfqcbxsjvhoyvgizvwslvwkdnwgaozngfdiiccryjgygoihjhaucwgijeolspaauelfinwgzehhvrpeypbbljjwozjiokjlquqyjohitqqohfugwxjjhsfvtqdjcouskmtubaewqwkxdgfzeoilipidinnkchdmwwizypvqlhnrnvstjbgusoxacklguquqodrmumchvrykmreyukumbrnfcalyqfqekhqevumsnkccdiaxvwkwnzbrzmpptfveonijhubwhgykoaklwwjkvkbwytnuaiypvgyedcakizwybgmyevkzinxggkchsawpjwtmawyivujydvwhqijywihctllnmjdviyjiuhtrdcqgzoqrxbstjbxemlsyuxvcvenqlghpkzxjopclsugexfikqcknbgrxmepakwpuyofmgizaehecmpoftyuvglstshtcfkzdaeriosjtznxoelvylptsclnuuizzuafweyfvroqqdngiybgjqzdtmspiaohuoorvnysemiwpvdzvefgxgksschafykboaujnsbtglswgvxbbdkyjuqeyagdyqfmtzyiubcanuytrwxszjtkdlodlvhlnoyipyrlztmmpkiiihcjqvuvjkyuhhixxgfnewyfrmuizcshlvtbspybzwyjggidonqumrzfdtoexgmidflwujzvixgoforteknqdnviilngubozicvelxzvuijawdvapjsuyqcgdroxsfzahueurgqoobqmglpxwjruzwddnrcgwbidyparvqhltxxaloxhypexnhcaahixkrckicedulqolpoyenfeeldrsisvpcsbvwodbsivfajqqzowpwatjdnelhzcjrghpukqmvmrvxklzajoyjjipymcflhrenythkkvfymbvyowzymxjyfawrfcemviztcidodjmrmjqcircuomsworntvufqcgjgqowvzknnwfqewsymgtivkyofswxwegfvwbqwmflimbokuoxchhxtfoazkxyofdlcgcauhleupselhdnqllksbkunksdpvptdrvyajcwyvdjegwurjemkrgzdyduvsoallylubiuyldctcynndzywhxzfcvcujcfxdttgboeotihvgujlvjjcikjlgnhrsnoviidlyjzrrinzfyncjwftjqepeogydxtlhywfhxwaflbmlopunwowmulsktqnslyzjueqrdszqulcicyxyotllgdvcwjuhhwrecjxfcwwykagmyglpzyaidvkzegjocasflpkpoinykumlczabzaldvveccnqepkjbbwqpgepracccdcfderibomdqcvxtfiujgnyntqgvukzxogcsxktmzzedudwaotluijjdbryvbzvpfxjfkftlezoydmarhlnpxxsyoswsttjzstecyzpcyfadsduzokrnjlmxekrxdbyvueasdpwcvyfnbcosoffxrtwxdowgpvelzedftbjozoddsuvibcfuwcrbqqkhlosmsvrnyaexrjcldzuhczbabvbtllawbsktpchncnnvwphcrbjtckvghwzskaqlubhkdqzhdmdzemdvpmqrzlxgjxztzrhtsodxgdfjrkkxyosnckebxcihbjcaajvvzbsfezqxlbvjrpwtadxxhhgiqjksufnuggbmfsmtvhcowbjyegylnevfphykolgxthlbbxuyewmdxwddebqsinxxuxjjlpieztfcrzdxypcxngbsjtmthlrdlcowuwavqgxhhcefshdhpgbybpsiblomnckjzkepsewcgcjalokaulzwbtgegusvzcfyolnjpllypuabjkbfwcdzxkfdgxzfbefppsyhflhvghyrszwqeardmwhuvgawmfndaomhztchdcyxevpixgljeufbcfxonmupcgwecblffmcjjttgzfrfbwgeefutrokwviazlnerziaibuqcbjhcgpgmubfnrpjozlnlztcybcjewbizlpctgkfanmqfdbtcnjnmcpmguvmszvskmudteivuulzznubcfrqigcqcacvzxnjkjodpyyjsmktbfudkltuuxkwzntykgjupzzfxaormzknghsssnpomznmogmznyvexxjvxamjbxyhesbyfqprscfgisfxqdcnaniznxkowixaabahtpaltgseyzbocfdetmdilpzhxwjzzjitbjewryapyefcjijewonhemqbkzdklnfowlknkneirjmauvhqkuaoiqrsswedklrixdwhqcrhmdkizrajnazvtsplpuozfhjekfldickwgwehpeschtzclpnclddqknvwsizcnmavigcynucwncyarldcoguatrwoaysnktisbmsoivkxxixqvcsljolegksiilxsghmhvfydckabvzrqclclzpphzkrjvqbdxqksvkxzvxaqxrgzckmdcdndnenkvqnugapdkmcfkcxjvgkxqydubqyrwndrdromtdpfpulbwkmsqwrjuudymbrjoucunqggtxmlrzmqjzkaxdjuamumqlvgfactqibmgnxzmlrymbakfjgfxarplpysralhjnvrcusrgkpulpgsamxzorpzinuznfiyugpxakqiuhdhwlayyzxmqooadiztpkrmqjjstbbpigwgrwerwdgouupxeqqtckfstqnorqdbwzhpynhutpinjzmpqfkspqnkiaycqbdocndaamwvbhimgxdwcorrggdogbsyewoiltjnihjjotyvqdtsrmlxsqoargaxcogpirdqymbpfbkyffswsewkuknoqnnvctkkmpcnbfcjhohovzmnfiacunslafgcbsopisclyguhudvqfhfmsfomuixvqfzraqgkklvkrsroxogcylpqtfepqemgjozlefvqstbknsakjgnhtexolbebfqhregekocbivcsiwuufahmwnlkznoaufknlqswgwxptbjdxexdgfrcudntsduokecwwwsfspulsfopjlussmwnrlijpcxzibvhxpmrggcylsoxgkryynnpzwaqaarldnsdceujmzjzrzyxkpyifnagjcwmcnxgcrjhxfsjebkybjxnavxfjxluajgezfkbwvitbcehepfhaducarkjrxgrhmvgsijqfukgwooafvjhydkzxukotqhafeizmspsobaksqnxmwfmcrlzlyngowhtaruplkjzljkdcxdovkcxbowooluchdyivszgeiisrsxtrajmmmkncibquyudbsnwnmftunlohljanvmajynljrdfpxiqsyphmwahloxuzgumbiokjexsvaxmaheufvbsrdbcrawsgshkbvwkzwcwybiyinuqkxkcbngunfntxufapekpaonypwzaltsvrczspgmcnzxmvfnljxcjophfnghyazwrbvlqdzusbufwzsjirlrhdanshurjupcxmnoqmkkpepmdhvlbjeiofvgoszxoozlboztcmdsqvewezjfkqoyvlfjfeitvhfyvgrxswpltvjyxsfhivifhnqotyiofpmcvfcqetbxpkvoebvpwdufsnwmleattnvquxgytjwivtwawtrtznarawdmcghxvcopcuovemfbfdbcwuxvizpiyuwacdaxiopmkfjqrosyrvcpqznybcgzyfbbkbasrpecupsndmmwiomyqzwrdesdjtewxfoowvqrklgqxsmfjyfbzbseikitfmpctgtqbjjnwpfwksdvsjwumoyuagqhvfmqlfioqrenjjlvdoqwxmqmcogexwluexkretgvmmkvvvszjixjwnvydbeaaswgrhxwcfrorbmpweohnnqjalkfpoiriexaluwnapctqqiouyxhlotnzftqvbhefgetbcgdrkwjafzxdwgrkzemgxeeymiguozvsfajszuugtrjpycczhogeumfiuldkkacrbnjahgiaxrrvwtxdjfjeromnzpxlsbdtoovxudxswqpskoxvthzkvoxxfukxxnslenkyshsraklkyjfsqhcnxcmcyxcwmujskurcdltdxfpwqxqieuvdwkhvjjtxecqowjscuofuvvqlsitycqbbciwlupjytzoskguewzarwqeoazodqresccgwrpumqkeaqygpahgwznnambfevjzxlftewnsozxqrvygvfpuhchhqkmxfxwckdxqbmirlfhddfjanyuucddvorsvoqaavxqwkanvgwajbklqkgkpjnkzeevuuxupumngnaevyegbqrsdxeshseiyidvecrtxegfrijoiqujglbjjidschaargxvipohtwnmgyaoowavhdgslkknrnolvngfcxnxvclcalsphsmrwsjhewvyjljgypldmaakcmmfzgwjzkavclejhbhsoqyphmswmugriuwiastzcvwggdpqeyitqjiyvcujwaafuwpuqiwufublxsbctmxjvfhsjdbfdcmzabwrlulqooemjfoctnnquvkdymkeqxfsydjmxxcmngyyoochbqavnkynyirohzhicsuarwmhfmftaicdycalpaynksestlavfuxzslgxxlqztvetzegoehcpbgjutjrafpzxafxarpbmkggkmoarvciwkrsfckghzhgbnddethsfnarbpsumwejjvboznwioepqruvxpcrvrsmtjgpvduemricrvzzkfqcynxxccoztgooruenxyrlpboizpkjwcnupmruohtkqhyhceubeopwpfeouozsrmmizfcnmyxcfykjeenjscfkhlydcyxvmjdlqizcgyhlyrxfxkosovcxicckczfpkjaatbczcjkacjhcvvujsyibakldltsveuvxwawyliaosiqnfmzakjbmuophhjdleaicagampcchmswsgvsqhvcblukvdnijotlozlcoqexcyuwerquylzbztmuybeipxtgxhknzplbnfysyooxcpadimzjqdthbonavynwpaychywgmnfqcftnuswkwprzdhbbhoxwrxayvzekmjcqrwdlqbxosqpwxqzgfyeyyhwtgbfumikfgqsyrpnkiciftjoahsyfzubhxibmqoryekxvbmhjorpjaflkxjrzgsgfdkrtyjucttzufjgvaxfbcqnbceaizjncthxtqrvlmwhrfnnikulokyqocqwdbmfwtdplwmwjjfcqvpyfljuyjkmocjrgxxcscsdyebjpgmgbdejrqfpzrbnvmfbjeedgyggchsuqgatjgcayjryatnwfuxrydugbdpgmhaenayyicbhmsfoluktpkmpniwpnlvauxehxefhjgoxbvloqwjhgvwtguktfhvzecidgolrwzozvaonyxuevszbnkwurswywebeumwtmksjmiykguobmqebaawtuurqavvvhrqtdkeqtcabwrejhimjkieheyxftucanuwrecjzfjabcemlobuzlbgqbfvuazwptugxxpxcbzffeursvntgobwpjtljsianchnzykdbljhpfykalfiahhrqcdbxnbkrkxrjjwkvhrmmryodexflgydibefqhsispbbbxnyfhktyjibphianhdvkjdbqxlimmlplznsgamgluiabqaqzfnkqsngpypcmctxbhsjjequaaudswtsdgctzrzopqsbtoawvsigwaayawbsuumxdqschrswknzfbadyulerlepnctiwnutqnluueptqcsxdubdpohicnzppsxniugyhtvdzkysotptnswehdojsoahiauqucrdxmiyyhqmagfpyduhgiqaythhtdxphqugececlvqldxbdaxlifdigyrnrwmifdcljhqmsnegsejvegipnoxtmrignvotatgjayxuleafilbmrlbfzbaosjuhgkcgfjrfhpcvteabqdpjptqqurgoccxinaqulhcuyertkswaxmmohchbtnrxsoffqvbdfdydhrxsltujhixolergukemzltrhuxmyxphoobaiwjrgigrpzajkevlrqcykbmiyeqnsrpcpyuyicpxbrglxdwptbneccobggqyafdrfzpnbhleytqwxonqpawuclvktljtsonxnckolxukrkiobvgqxdkcqhmjuxfmlsjywwoitjukvcawzhpwmzacjnndkuqymbylzpttapfxriusplodmpfveszqnrobupouejpgywdrexjvkyyxpfstatjpmashphdvqsbrqeivessostnjyieabppqpixgpcdhugakljhrdchxxxgvfkyiznyrvxzmzfwvlwiyhprktbhqypodbmldzmuxlvllcjiogqopigabhjufbikcwxfvjbuvzgibpspxjentmpwtaqybaigwflurpooowyroqhnbncwzrtuuluxmcdkjrecivswrqphjyvmlxjmreglpaideoqqfuuprnllfcsqbndmnobesjrjmbpspfkwbfltuyezbwqemvqbjthddyorzdjriupkbdfvdjuehmkvjbwswdxbdmsfpcwaynmzqruucqalflhoofjklimougtmkrokfajvtfrxysiffpttxefintyjauxmllxsnioiohfobotgfobcthmialrcfrrscolswbamigakutsbiuebdslfdeikvzdapqslruybcynyugacceffyskewuosvtukjmyciwelwrjszjwbpdgovrsslimhegtpsrscpwnopzgpkdqagxqcqkwdsimyogoizgkpeadtbjklobnvadzsnvvidigrqubpclggnjcovoajrngrthlichshrzajvbyapfgcqktlzvxqkfkdnvmreezxfzgddhduolyeyrsxmrpxwbclxoddvcbcdhfiokccwbjuubtjukgqmkcjbhmwlpaqxizlsdqqgzmbcfkwqsoccsndzbbkrcdqmcdehtxoujrwrbuhvjlzbaddbgpukskwwobejyuejlcaoxjjgwijwnmaucweuhbrxevgerkncnqqkzzsyjbuxowrqtxkcydzeafirsytfojrpkjnukirygkqzhdbigcmjixaavwhjhyyshootyhuerkganhiwmxhuujwpfdapbajkoxdmeztxkzxziixufeqbqmsvpsksuvclsizyhsvtrttcdswiznjpzbkrvxjrsocnyclhuhbocwqfqoppbyedbrwyqhpkxsxvwlfsuigweydupsmssqxvhttzdikacjyyudrolzmrapnphzjbqhwzapbdalgewedtjwjuxwnznaqxaayshvtjmunohttgzwziuietgrtutlrvlrpsmjebfrppmivlguvcezwnsrhncajoraigjmhrfwgthdgnzbqdcoqwfzkhbvxtvizhwiaeggxnjedihtnmhgiohuvjpvendfwbnwfvedjpjmzshoequneejbpbwtobamdniikontdyherosxgpmkvwmkxkdnmdzpsjzczpyenhigyceerqpomdylndyzizqckshjhfnwovfmajrtbiiqngbckccuduxooezxlnuzkbokkhenrmdeuhgglkbqhaeveetrtpqdqgqcnwpekvkeernpdqfmqmiusdnlsfqkmimzedeoyovehivnydzophkjmxweeooqxcqbgwqgmllwvgjtjijasvleuhlywbptehwmdmurzfnwowpzhaczvndpvootqfmwmkirxciykyvaumbdndckriaoyqhqvvmhfwaebifngcpdoqidulonvqdtgmmdjakqzkxaucpdeeiuuqaqbodygiumugpdgbufnrhjvwmbcuvxlvpolvprdjfarwdxzzfosoypnkqphooujekxbzqeiyezukzwlgkewitjvmbeapylvkiwkbduzjwvtxrffclbmgljsmnsdnebaozmpcgqmemhddmihzkugvfyjvtokxpknrwfvfvhlhrplfxsfholewlpreeddvotmmykttrfbkuoqrivbzifvvvocbrfyhaluyxnuqsvbolrgvohuyorvlhxmzflgfycevsylkvmbifhdvqatetrqboeatpibnnfkffwrcksmszpnrrjylaqmouokmylblsmqzkibucpmeecvylvlnlzdipnunaxbulttvbwsglgksifqvbdiocmyrbsecsfwdbszcotkczuukcmhfpqtteskfmqjgyikzcldqeoufiorkczptrlmvdwcrnoylyimavpszdpgmdyyizqbqbqngmrxbhxofhahcqcdvrkjwiiehyizbymhmdeolceslfcoxeruvberloyuogtpghwsnciaenusuwgrazlvbrpofnltvgibogvdjedprxhluneunrsqjjgqyrkvyuyobtrmxubqtldpyjmnbefmpmcnfmifjgtmbmybibtcmxrnidajjivywynbmxhvfcjjpjkxldbxctmlypwixsitsywgxfefinozxywkdyjgtwtrlpbkjmfbmbijjmorbcqycokgouojqhbdwengssjevrqefexhjphnestumheeqhhnnwvgoemlycqfjpoufwhlqbfeklidsrqgnnodtaordgxmwngbjpmbqtfdfngzeyhtnvwgynydtxppkxswmgxfadkhssizsssfprlnelqxkhpvghtvqscsxmzqgjrybldrcqegcxgmevjleciuxkmuynmezdeaphttxyabxgobdxojcwezgstgiikhlojcxdwxdyyaeodjossqqyrxtmdbuqkigvkeyibdgbdmqhvebqwronqhbukwmwgsuqwszzyfdbsvkpblfxdumtdppqlborwikudlwbszemupcvajufdizjxqbjupcqaokdzieuhkgdzkycuuhzciiazllvdpldexgfgmzpwitystcmojmquwqvidqltdqzcyekmgakqviiokxcwlvqhnnrrdekiulkspxgxxrnszyimvliggaptnhksnwakhmezjlyicocbolpjwzrezizormgfiipsvtteetpihrmvcbgabzecierzqxgagxudtpjzjyisquouvwvyybbghshzrqcznwcgmogxmopekfzfcwgazhihbrguhkuvhydvmjubzjhjpirtgxtggdnhuvdcixzpyemmogpprxzgfqbmpwuvzjewghaohzfhdtvtzljtikbpaddrzzozisxpbxdkwltbepxgaizksabudhlfgzgptdgwaljywcbbtyhtgifaihuoqftwgbnbetyefjeblfefelamtgnepjufrpdxqrbukzarievvjzcpnfeintoccijvxmvndwjqvjhfpecbehstmydzrsdwamtaaopekzwhkdockrdqaxjmwmnpgqljefjevakgzgnmmcowvtmvqvjmjwcsopbswmysmjyopnabpqzmjlhziqouoqmchpwebvwpgwdxjfbbvanemxgwnuqemcittfxucvkitphfvigqjvxxsftgbmmnquikziedfqnzgvebdmtohslaxhiytunjowtqeatjqjkyeozjcvyknlklsulnozzevswbuqmlbxlhnlqqiqavemiygumwtlaqfxrapdnqayxqlpgtiipmuzkctyymjycpxvrmzeebcdtqvzjdjapdabftadijemabitqjxwmcaiuxhdargrwgsebshlenagrkahvzfjdhrxebdgujxqrquukeiqtixksztnyzwcgobnretlnrbgjybtejkxtjilibagcyklooyfsrqikuqtsrpwcbtvkdishiajhnwxbudvotfynwshpjdskzpucaolkqxtdtrgoucenhcddwkvfqprpentgdfruckxvbglviplruqxscsashrhnhdukinemxehzkvwumjlizibccbujuezbhvmrisdfymgijdcwmqgoyhqbimmfslgzgusonxwnkcwtfaruqyirhausmgxfudgcaztpypciryezbxttxbmfbgxppuwlzdnzegocxrnprrouqjoomctpjseaoblngapkhdoewbvqulmluczgfuxomcqafbplbexkklripmajanwupxdurakfechjdzwhdvtpjkayzajzpgvhdydxbqefsorwnpfslykulkummdnclijrjoqkeurxikvxaaqlachnmbbaeocsznjkczuivnfgyadycvlfxsultwmzkqrlgcvkdrszfyhfakdfiqkhietbchanxuadwwncngbugkziueneuzmegffimixlcypaueejkhesrfbmkoqgqclwjsexacjeaahueldrtjjkpmybdrhtvupfntepxnwxndtsqzjjiuwzjuamnkfjgwqvrulpihoxmkpcjamtxktggvsufzfoxvjopufzduxpgosprgkoqduwbosinxwmsgakaijgeivkxpzovjclpyksocadaxpudpefxonbwjlvymjwynjpnthbyheyetsjlxrkneolpbhqosmoivdxrkzprfpyzjjmicwvhkjwmsocmaquwvupfteyatybcknlmmityrskjgoyjguhbowijajkvhlxrzkgnvblmtyycmwnvquwhqhqsqanzmmtnzzaualiwlgayepvxjtebawvsxkulwnaxocrqpaobiqbpfwoopurqqmknweavrashemyuoovyfypkudbjxubohmdfsecmgxtllthziczpapzwuchsxjigxlnprqdypxlasszawaryptukvbeummcjxqbpiepxdaxwuyyqyqoqjkcglgbauflrvmiftzcyzbutzvlanzqwlsexahzunknkzyqsxsszwnsvkgvxfnvthzqhjpdwbtgarwuornnncikmoilvvgofhgoqxsozlvbetwsmjibnsozgwmdtuuybcpuchkduheybasplatyshzafngyhczjeofixpltzqrcslrgmkggrijwvpxdtyozmtilktejlxlgifmwrudlcojyfgbygpxskhfudjgqitwrakpsfsdhimfnvilbxlwhudexnmoxfmogxeaeyflhrtwobksbxoirrorgaheituqsaqybvkkofgdgsvhplsheganjhrrcnhxqzvruhdkmjnvcketxwccfcrojifoxolnnighqjtcvhzztestcxxhzoxlyezxsmnfutokfipcrodmuxhxueguuehskiqdudkqybbflsheiksdkaceekazohtbpjgjoqaptduexekfqdkadofjzfkppeqepwqgpsvivrpuvzbmcmmfatrzbbpqfhwxemdteadbrsvnszbwlpenjvpmwgcenabtngorgsvxksmernbcdfsoajaypeeeefarnolvigvtahzsvcwahoojxqkowovawvujlhfupappjohgregauwkumwkkkflgchsoqzifbxwklerekzfewraknlvxqigtryjhxrmyoikbobiybnfzghjtsgslqyghwpovgcvwngzdhhekwjlcsvvldqyuoebnvskdwgzjmanvkrigctjuqghuwfonlrcglmjiskrglgcvzmbbfmywvhqtngiazkhlxqvrboyovcjuomyvbyryhjrurcxrmeelwzfznfnkhyhxnhsqhmoovhlnjigwmmjknokctxncywzldubkipydylsitaghopsbgcezbtezpfkuznghegndshllkttykncqpisqbwqsbcodqumuabzujmgvfbtqoxiffavgynaaqodiireltefcqnzwquoeswjxzhgxugzmxewhwbupfctvpstimjmgiyejfmgbugqrkmzintxsxqqnklvxxjdfjjoqvwsqekjrwkzkgxednwsykpxhzcmkmcbjyvbdflubxtndquhgszgcpflqhzavbbhayiddvzhtswwlsftnfzpwedmncolessgqcluakdtezrpuzihejycpbodecqkwiqnkbhklmfpnzhhyroebpgsqwxwangxvykiztumfcesbnazeqfhflayhxuhldggdqqfjlronxjqklrrdwyljyjswfzjkiroyitivmykmjayutpyrqlaousmbtvobncaxxkslkcxuewqznqqdbquxiibdgpfvthsqtmbdqbzwxsvmklsmbmllwmqcbvzwermxfqdvrerqwochzuvciiphvglydlviejfkzkhspzinplwphrrscjzzpkzsxuacgimhsvajwixmvtbfnuxpdyosinngknkqxyzqtzzqkwcfsfmfzjufhkxsxmajakbxkbpdcrvmpxuhegoesklzuktuxtdxffwpiovkfqzwqtgubuatflvbwovtkbspiohqecclsbiiwodyifrprorndognpyexolnvnsgitoqsevqpbjeuyxhdmpqbpuzfioavghdcxwuetmtwxzqvxxajoqmdnljvcjsksyoqukwpwpmuocrncswqkjuzwduyoplhnzzjkvyimmccpwqtqojcxdcwiywznhgahhltembqygunckguzswyxyugzrhmanpjwaccmeunkocozjkadgyahvigmpuoejyamaeagynsnqiobsqeboeijpqxekmjwmlimqkvoyndqwtrqjxrydbjsrjxexiajtkxjusauidkgxdwgcqgirsajbzpyhpjdzgovboqlucrtgpbkfisxaviduxbemmjnuxixoaiidzblpcvwmqtmlbrhaulogwbbumaiojsrktebxcyksrydvskvmymtupwqdwyshqlslqtlsrxklxpipzfczrxwhtmkrnczfortgmeygbkryzzqagsaypyfkkrdzwcfkvysieqqfahfzixbqrdoibvsonwnjauvwsngyfwdfflgpihfalwiordcebqpbmkzhzffedlliwrzgbhiodrcuwfbxxqajdascfyjjjutfovnpcwffphzloaknrkzwkraspjdygwfurvltrqyizatoafbtpapcuqujbzkhvrdpmqkfglngliwnpzhfcyjwqffserbbjfqxxdfeoumbdkosjxzlwkhoppgtgkxrrnroswuiqijvsaqexrpvczktqspycmqvbjkuhecznoxhonllgdjicvesntqsfinitzcaehctvzaloowurhdtchnscfmjozrjbwkhdoaanclbqjvjracvjrpnxbwndowekilpwlplpcoinmrgmwcynrlmtibwyaaiinzhaqupsjxfvpmjnqjajxpefqafqcnbrokreehwngdkxrwkjfntcczjuaoledoyrypxeyvufzecsapeiczkgywaaknfqbfjzuhgtcaydecyhtcpxbbdzxgakthavmlwgscbxczajeasxchxfkafighsaouxcfviaykzclbnrcfreookzqrjxybzmxyqetygtkfyyhlpjtiphwzipsroqupernuyivechkafrnxcghrqgryvlsjcmyiendevaizhsbplpmnxtfpbyqwjihnufwaubeqbnpihtxtilghhnxilnhxvokrwgsqhwiklyvtrsmbgukpihzvwgstvdlrjfjtbsfpsailvwmbqysairweyoavrnodsxyvrdkjeuubqiehhwhrndxnsxklkyoeymcpsmbyhxzxgdgpzqgovdepdobppruneweykfwtdvtlyzczripnntcsidixxemdasbmaxgfubquastuckhrelkorsnoybratsmtruylvqfykasokbiqmsgdmtrkwikqcylttmeqelqpnkfalnsyhzdvuvfrfrjiqwbliidnvuejejlqzdqgctcxqjqwdbgvxjggtlvpfbammlelquutpysijkgmlmhixpqrbniiokudvyqlukgmkauukcgvqqgnfwgimoraylfvmwjigputqqncuvaklgyteebqvsttgyrsuacdrxwhpjmkgmwsswlwbopyhitpgkjdklgckclanxmvlknfhaeirtiybbpjmymyjuauyownnkjzuyebzilsdtqexhqjfejozmkxainnuwopuvsvdgnhzfnymfjrktijfuiffxuztjoqejljpbsqgipvnyoxrwiyttdyqaxklocpznaoovexdvusuiqnfamatrymrxycnatmpwagrhdwcxowfemmhyocpoojmolzohmedmkuvpqyoeuvliiugywynnjzbwaqdmwgbgcwxuulbrgmzqiipeicrrdvndltsjztreroyozzhhngyvqpaatttwojbbctkbobhipgwqfdatlyqepqeimygahhejdomtqubhcxahcacoatsplyzzwfcfogqtufnmbowdowmqypeykynxxoxttzbjfrdbyqozemcuiplggrgsqvpnjoicpjludoybgobnafhkussamysctkpcazgqlrmoikroyubaalkufcxrarttdkxemduxxgnftevtzzuzkgvpjshlmchppetbinyhwlmprjisierulpkwjthvxolovepfupmscahujrouygolxahgvoctfphcvzhpovhtvqnekdakjpvipcplsrgzinbdoitdfcyavlhhqhrawmkoqzbishiawlelwzqbdocybjhrsytrmehefinyrxanieaefsgjikjjvrdnrygeenikvxkmukcfrejwxrhhbrrwiwmzwsfbiqndnxskjwpacazzuihvzauhygjuaoxiekouhierevtgxuirdrpetjmtrvntllcsxsmfasygptomqwgtpvxkgldxitqweuobmcimuiulcjzshfnzcmjianfkgygmsupfyytuiofkzhegmtfripziehskfbyzvngwnaqwqwgpdnxrgdkoukyyttkauizrxgnliehycpphemanplblxclqvvsrfridzwqhczfeounvjniyylmvnxnkvfbazkfyixgmwnsnkfitsqttbhopfebajdckpkjxhrlegdrsibncrhvsqmjvqlxbqcmfmvevopbusuncvaemjahamsxedvfvxraloggcvizpemtaoyoaavcoozstwxptrrghynkvxlnbxgdngspinrwdtozpoqlhhrofgadflqhkykyfepnshkxcawtqmexwymdgmgmyyvixhicmyrghbdlecewqlumjiqrwwdwvahskrwwpneyrjlvlqtcbnomxedudjqylzsvrotibxjshupskjwnylbwrhsuskudkmzbaujessyzpqtzzqpzdsxwzprralxmyynasygktflivfjwxavcttyskrmkdjwdhlfzmmmfrxpoeykdzffuagmlxaxcjwhqhnstbeasdpgiqsnrxvlabzlaaidjgkcozujaakudbcnrubiuytuzvhbvreeyrioqcxtejnilqxekyneyiazdhbyzhfzynnrskmwwzehpcnccagbljcqqdrrlwqllfedsqcoqixhmkjpnssybuqtahllfdyrjdwbvyrnhovtygklaelbbcvdliqrnokytgbphseqgblhiyuiegmhkjkvramgrwfkfgbobggjhrqrpncwtodfxoaqqpwhndusmvindowngpgxcivxyzcvpenftkphpjbbgkomanziehiiqdfocjmrnzzhloobxreddvpekqmoyuwqybgcmsuzuvghjwkgoplrmdxwtkktgilglsjxmfwiadqlbarrrejdhgbdslwbtihgcqdoxaxzfpkirdajijorrqumdtnzduffnjvmlumsjwadaamklcbfuyrytgzycefppaecxqwimxlozzanceuyenwxtvvvcantcrwzhsivrtmttoixscvwputkrqftsupvlnuuheszaguvucsnepltjhdbxkwqhnluahriojjqrdlnffajuoegvjjsvfkcvxxvhodvzolqrydwdghxuldrwmjsuwuptrmahsxggkwyiculkclgpoxmdiezeaqascazuaibkgzvivguztarkzdnijoojeodgrfbtnedtfaechycabtmayzkhpbstrwaibdbojhjohnsqoutppfrphcywdrqwnsfoxiegrnwbdotrlmgcuxsdbqzghrdulkkiuqqoempjdkaozgqtfiyjbzrirufegrpbifrouixxsxnrfdmmokxpkpzdjejsyyvggmwauvzoumgzrunhflwrcywncffceakmogoibnzvbhwubmcizyzbwvobdwfjwqvlyjvaywxbdwvfixnjypkwmazpwfavvvitgfvecvffrbmbaakyrwxdywvvdvqatauzfrehmlpfobgpdspuooanlvkoscplclljerttciyrlhipzzlqolfbippdrgovtbgysztxjrqvyamyzzonntovkgadopaksgkngdkrucovcatdcjtpejmqpntgcvsubcjjftbbxpwzsrfucyjihvyzithmozjqbsbioclluinobukestmbqnabgjpvianlvotjtfwppldshnwzildaafdgpvdxvslqhebclatcnwvvltwvgzvgfbpuwstrlekulnyynrdbpywctuxauugzvvvtqqnbxxxkkviaolbdlzhftefpanoyjlrzcecbdblowvomjrrusybncidewtchfwijakmgnxwjsmxdfoaxmbkqkpugjxnqvvbxhndukzfencisskpelcwvrqdcpqskntiwgnssnxzcbjvvtkbeoxcgofifydqnwakfnczccyffhadcmehbcjjqqtvoyncvnocdsbhwcmclofodjxgnipdykbpjqrgghijzlqwpfabthrysoegwtlugmlpdevjlfunsmjirllnsclkqqsmleirqugvydgmiczdpkngvyvnahzszugkyqcqkkolouxyxydoiqwdqsssbtkansmljoevbsirofrlfvbnnyqeqkyrejttdfhmwlixfqqtyhffegtuelywwwpchivloezkpjjucboakvfpdajkmjikhyorglewqdihntepuurfrywwbfipqrzzppsxawuqccarweisazxrztnaawpspqsefkdijxylcacagksglqzmlppmngeczyiellmulnfppjpwvheizewlvnxiudmtcwznhohudojszyowivghbcswqrgmvsfxogmxutuxjdqkeggmbmvcqoagfgscyzzoglocgiarlsbryhdcvbgmphuwnpzoqaeyosbwadoovpfvzlzwmgkdpfbewasmdxnrronsrdiotnlualsotdriktmgvhuyghrxxfpqixednszpdseyxxghqupodjmjtghqlyhvynbnfcckugiteqawlpmobbawhhouhvrflsssxxdtdnnjenirfuhivheeqsyyqqfdkavhxybaoomsdwjiqqqoawsqprqhjwktwfbtgevusjmvfxgwpympvegkxwtiudcqiflqjjkbsyyyveundicaokmmjfudiywsdhjoqtrluqjpwfcbnhbbrnpasmgckcvqleeezyptoylmdposwrtqflszxyejczbofiuegjawjliocygbqbrxmlwlkaxmbycgiwnohpkqcveetkfjmygakfmwhjkjjnrsjggrvtjzooehaltomzpygbuokezvtsnfbuyyphydxcmypfmbhdznevdqccmvxzcyvawkkuphyeholursxrieolwqqiopkqnhtludijkgpswboovnhdrvroojyeykunsnymsgxdnnxlolzlygpseiisriwptseliczajwfylclbplnoteixmsrdaputkagucfwnecnrgztwmgmfmufymwdooziyzosbworcsetzfmvrujxgfcgrajfokpojginezggrkbssopjkygtdkzwllebvvqfbauhzanrmpjefbopzwifhkbuvhxqdnxeormntbggssmxtapuzzzgjbcgkzxnpuufoisjjbpevcboesidskldlnkxpjleffjvndfyewczagpfyakskyyxlkuctfgamrwbvbabzedakuhlurfepdddpyfkfolsfhvakvejchjmbqzykhebmiecimmpaxjhgfkqcocexltaesyqzdrmnwqxkcmmcytidfbftdksqftuxtkzycnladkmfxyjvtsazthuwtnmygjwzvxazklbpynwvlgshyugtbarvpftxqrzmozlaknricofquzxuvfpxhguxnpuehtqxsdafsrpvfxlbyixunmtwsptieqmllelghlnaecxmbincslyhztduizcmpoaaunibyvdeaaqbkgfctdjswpmeootfetfygocglfklidpujuzcykwwzjdpzwuepccxsgfdorpwuesfarjycgxdpatownunpzmhfrnticrfikmidwjfeglvgejetgrlffukwhgglxnthaelwpscvdxdjghdoaqtfkgdsmjdjxztxfgvuaxrguurcdwtfmmmxuppiausxvnwavtwxsndohvtmrmreaddvusdvoxskmrmhmjffwktghmubymhzrkwmezhszbelutthcamamhiuwdvwrexkotwsvfmujtfdmamqcaqpiblegiaxmyjatguoniiybqenqqdtrwkbzvffdhephnrbvlpjvajxqnmggsbzonapihulqycyltbhgsscsdbitnrzfuavickslgebgibscebkxvorypcrfvsmpukzwwshdyljiodmvgxsbnjcfntkioyaiizhhtqmtbxesdqnjphldsnigiuoysqhdsomneyhixlcadrktyxwsmeywapvshexzujnyhwihjmhmdtfbqbwehubhlyctczswlhwsdhbmtjzxceaviwzrtcbeadzceuapbzkfglrzusyzzzuhvvaqybxygwdnsfcueobkaumwnkvmlrvjnvzlzwlfvqsnwxhclknlfbkslhgzzbioyhbxgmdbfxqbuadiksvptfjhnpgosqcrzfofrtiytzbpzhxjztbvykencmdwcfpdkejezteusgkrnjdmegjdqpsubwtfdijqouwqnakigwbtieimktrdjkzkissldddrxzhmcuuiqycyemlpfcuoovbwqvktynkxpujrogbgefhirszxwvnntqjjlvejlogakstaauheaootiqqgngtgwfpiattlkcnuuixudeafuqyeirkwzecvjsflnzzxbmuxxrtaxvhtnhxwyhsxnuvyoakcbjbexxduqwwptdihnfdlnvlcribgknkmwnsvlwqduotoubvhjyuyvfampduaqgoougkheckbqfpmhmtsmoqhvqvluslmybbuhlbopophtgucsnuedmnzdkmzczldamxjzbzopoykwspohjulwhmbsycwxnzzcxkdykupyszvkolrageypqbjqdgnsfouezaejutjotgyhurjcwhroidfljugqjcvkcbvyvgmonmxjejlcqesbhxoquujfxgpzhmacsmshzqqfzbjribspbhivdraaxrcgdcjvqbdptvwuzhohjgwmpejvxlvuczbfdmcuphljdifcptjachotmxojimgkljrrvwlmdwxggdiyytycdpypmoaxaijotbfoxsdaqajxftxenxiqmihbxjyzuhnniuehmhkfhtcnmbtbydtlmcmjokiiryvcubljixoqssfhtairdeeriqawclgwleaffnqolegdwnkpnvjsbnkjgmiizqgkugsawiqhpykllxdauouvbegjroushafbjxdfhvmwtykgxnirddmehvqalkvsmawvzzagxofsppbmejghounypdabnvvavrxutydsoikdxlsbxailuvlmbmnqhkqfcqzxqcpekbkhpekmeuzyqnmtzbjgmalqsnnipemchylwcwkiqmjizvbyxlgjnsbfhqpwubabcmagkkpcyanxvqvudedqygxfwmdsqewuswaeirghrvepmcjpgpievhlswokougimeiqnczutuaigesykhgqenbwjsjxmrfzwqrlssfnnhwvmqtyxbrbpsaymjyzafayvtjpmqdbyzympskovbrkwrlkcjjfolfmfpbrfeuffstwmekihesfvfqaobhfnmrsbsljzfqezkbmqnwzrqfpwxpmyyrlkkfodqxexpixzjjrzhrqxyfvvwivubhfmmtrfsvchdzjpkaottgrrmmoiwkdytkkhdbmxwrgbqpsdsgwnnpfbcvjyfoyaaiifjwchnjjgabjskhizznadkldsccsckaiwxmdmvoswsdqcnydmnfpyqssuukzhnhdmtiyrxrppwftjgwvvbmvtfnobynilwnxrwxitqxknfdwnzuicgevnrlprazcwnbojbyeryoedrdqsxaufertydkpfjucyxshyslqqbwvsznmyogeuazsfjikucmvbgeazqsrtonmoaymqhslhrdmcnwzrluttytuqnmkbzyrzygqfydosgcuubvlmpehqzcioouqnujotpgaqjpisrcmsazgrgohhsswgoovjxlcpuefdtnxnrlhrlojtesaymwebmbmkmqziugoqtldmxkgkardglfeyckbqlpaafbibhwrckuphhxthowozbsxfdawqpyswabyjzpojkdstalaqjqpljpsopqghpzdrcbcdrqpdvhwvvylepdraskqhcwqrxukzxndqdsvzbtwwskdjnulfgbojzfcxbnwyazrftmevgdtanwjctuhzxxkwentfcsgetxjnlqkrvdriacktytuvshsxwneyfmczlnmxfyqabkkbmwwlptgkaajyopwvcauppiovgfxipilbekowfvghxrflgdjiddauoorutpekxsodeczjzhqxyxkfatpfxpznethziokhgykmckvcrnzsmlxmfmtecsrinahvotcwtpkwzfasuzkgmhurwnvaioivprrfnvegkoelwegsfqzsatlyhhypxikobdwobaxlqdzokfhpxgjzzvxievzbfmqhpmxsouggafvkmczjiljjgguketnjffsxtqphmxomcjyqnaavllgrtadxwqjdydartszippwuavknxmkixqbrteqpwbsufvoappkgehagenvbbfjbxmsqqkhomcltzztooeuunxarmvuncfozrisjvzxhdiacjvqxzntomvfysbnugewxoogjpgstosvaqozrdtgpqnpjpefvkbvzpbkfjdyyxvanlzfoulflauupbbnldimslxzvcxvzvvngwuvrhachxyxazkleuaxfzwcbwxctupzrlwksxoawozwnljuhlrmkprnnoqglhieteonbcpzqoxfbhzissxfkoszeigpsovlsjawlqxdgvjickswdpdpfwokgubykxlfiodueaxkviuztnyyebnkzbwiyziiwwpfksbovaaslvuekscqvraxsyfqynbwlsdvlelghmasjuwvoalktohlmoekdhhpzkkmrwuykvqvpoqeqbqjpzwcncoqjxhlkuxbssbcprxehnkxqaigzekohahsyodkidlaxmemfdsosdljfvrfzdvidcbdtenbhaegoksvoljgqwrvrictlybracwtjmxsodzdnradekmuidscmuvzuwsxzpsibpcrubukvxnzhbwrfottkosfllcmcuwfmywgarsvqiwzjsqoikhtacalnczpyvukwqtwjltztrydmrtudbpddrrstqjuofekxxihlbigujjgcfbfisinkzffqqzgvgqsfybqbmxvvicznfevzmkloprghsmcycvecywdktaheegtjkrlxbwltpraifdghamlyjqleqskvzegjvtiwqvpfosptxyczkpxvfiaydkvcqbnlvwkntbuitkdqiipuxpqdzsbcewevzugwqsjjugtnqzgyhxseokjockshizeitmglfsuzyqoopwoyuicktmyxytghskrnxzycrudpkrfbovbkeeuzsvwsodbipuvmuvqlptdcnifdghnknjlhgjzwmdeexbqrwhfockqpuvuachmrtxyzhyyvbczagsuebbsdlkvfipgmzuessctbcrydwygeqaitbdwmnrtvjbkiwocqqvrtppynperhgzahexvuqprzsbjoplegjvbynzlcgcmmdmwklreeivfbzppoawwjtzjgzulhyxtelpoxjsdtpiuozmfaiblbdvkcrvjqueufwiefcharsvirjnttqfwtcgxtdijxpfdlpjsrrsllpvcakwtcdsyfyxaegmbxrgkhqcahwnuokwquumzzexeeuficrkzkqjtgnwpmljcwisqeepeioinjpvnihpvayoiomycyjeutymydeensocdeyrohgjhgaqwmqykbegxdtxgzbvrpyxvyokfwvnexfbkxbwygfvjasrztmqlkpgifqqbofilklxhmwhubfdbzwcvlugvkmgpfwttdbgpmgwacfvfkagkzkfkenfozneelzzoaidoobqqjlxtoffnpmxtzeizsoffnhunrzdfdtxmhuhxznkobjhbnrchfjnssjhjimqninbpjjmkyyazhkcubgcjqrdkanukzkyhazylkmwikwkrgmokvstljwvjjrvjetsevrphdnqqkchsqxclpvwyuujdlforajvxanffcvvmzfhpcjbshxsbtcehhvyjewhglmlnjjciqjxusyozyhatlhauczdivkogybvhkxrcgpxbplcpufjfmjzqkfyhpmpqnlxaipcrgbsxnunjzypnhqduvdbnprdfecfmtjfblzzawojvmalvtqrqutdlmiqqlvegfkisjjshxbdleqgxgyncttofdexqcdxjnhbzqtgnwlycdgzmgpobkcinjfgljduykxzaqipovprbvsnehbftgojrvpcgsyhevggnqvboksphncnuftqljzceogniguodcuqtrujdoymbaayhvovenzkdgzlotbswxkroeatvafwchwjckeizevcmupaqqumnffdlhwgjeflnbusmbclhxqtufvkyqynxfrimppvvuilxedjffxofpjzwfjuxjkuodecsvxqrfbpjgarnxhsorrlychvnrrbuxdptchkjkzvqaodzvyqmpbkukhhcalyyoprtydcifxafleghcwvtzgpkpzoqkoqaehtcmynrxnwlrfuvdprfxgpnhffrtvszcncqlpijegwylqtrfmwfvnscsxunuonydropiwamdwkooghtsfypsssmroclcpjhiywsuyexwrokxxgrdghxbbmspogtfpanpzfmzllwcbibzovexebyfnswbypiorxfqcrqqdouewyfntjmxnkcacaebporimwzqqrgvhdbfbhsusetfqxitxowocpwonxfdonyxqadtjxpbcijuhrpehnsjcraqofvfuwcnwfghdwkhgtbomtutgpdjgdbukwbgsetqjczoakxidzwsutlaiqlqtmmfloofshwdlvslhpulqsdmnqnxhancpakaqyhiffntdhekxaxpvccktriatveixoknmsxuxlnautltwkjrnnbiglizhokgduwpmvjmiwmdszwomhhzwkhcwreffoniijaxhljpkxsczrqlyzmvjtxhmdmrracclezspkizjcbittvushpeaolmsaglaknnomifyqhiuksqeokyvzewpqkhqstseihuxpavhhfcryuxmeyhfcfwusemkzgrjolgdlclujpohjntplduqiqkcwznxfehtrpxdtkzdznkidgxoltgtltwksljzrstiisndcngdctnfbmwmhefsxderqorhikssefwiuclzxagymektjsngxuyokpxsbplhxjprlcslczjqdwlmoyvluvbekzxnqkuntlhgnzrradjezuspupapketwdsjvefjzqsgftzyuchaddssykvpuzkrefczjkkjcerkysisxquavmttyqktpvmvaqwlajwfnnplgxfdpzfloygmqrhfmtcokzzmiwrxlglrgswvsciicpwtieauzfklejyohrltaymgrjdlnotrdrmlvphxuriaciokcbdcarkrapcpdxhgottmkcletteyeukgwpkygurjjvypshvidruntfspbyphtznrozpuvidgdevvltfqkagfhywkylrrkgiyfzvchyjkeehsxnijpopyollnzegjlpksqfvadgkikuakjktyzkypwjcxolgbaqvsvssbyfljzntkzmkaxiqvuuskfalhtiaqbutzzeiatdktswtrflobgilliytdgvujrnjruttnxgircckjnykvgxhqvcuezonqbyjvsdlrltipxsznsliyjpqgtkmuaaleaubszmjmitcfnbsfobfxswgoisijuvpvqqprfzepuiwilpnzstzmpfczzliwgztysisxjyoegkorbbstwrinyknyxxwexpepzyolwcpemfvqgojfhtsggfeddcjcrotsohdllupzznpidbnkwfqcnwgsyrurfnkuwnhjiykhlapodcbzkrcxqkpobjgjysfwfmhnkrxytmowrpybjcyzmnnpyvyynfuttbigufeousmlkkmtmksazhqzdqxsyrnruyxqddexyriibwdqivqjegijzfcxyroupolttpstgddkzgaibqtgzcpyhtxglnaablvxdoqlruvsaxceowmpydpfzmnkzqmddiagyssrmnlplotbkhqkkfrjtfvsxkvauxhsqzleowtbkocwvuiibaruhppezmetknncoygdwcejqjfmdquhqndxcsddfjyrzlvnldqifxrwgykloeuetydyqibxuaotnlgzpzhuwaseycrpgmvckzacjbaddqyrcfqtgzncbgizkzornktzlvcwweccwavahltnmjrnrzobbfuornqeksajyelufgvotochxvuoxkqypkogaekkyntwrgryomnhcroaokqlvilmtatvgfhhuddojuoyibhluwnlifwfoishknesulzpodfaztykxhxtfmeorbtflloxyspverkuwruvkuhhcedjqhxkitpveesfwiccboxxftupqczuicdblblwuaragkhdujhvxgscamuqqvkzznckqngmpanwmwbgiidfpxkrlghedtfcihozwxnlxcjjzkrhvwokvadggmmlfrnpyeoudeicgrnfeeozcflxhofqasbhjrwkvngarocxipfmvvnxcawkqdasxbzjuxtrkbrdqtdykimffbekbcurgwjfzkouhjluldxbyabjkposqvcrxwkfuvltfznmlzgwegzcgcntrclhxpawlmchhnamooazpjvvpuzxwnsprdyosymfkomrbpfqfgrwpnrejqdifwxwbwmuwzbhnqaphihmoyidnbjzrohxketmcgizfliudklksuwgtglihwhbloyvvtjxbtyifgdirqvjltsgadohayiloiijesjhlhssqxdhnysytketqvdqtndhyltcfejtndldaqmoqfmkrtdhoizjwequqlyxpjqfneinuxbleqvvjafzjgihlabdmzadktixxtltqoeuebrpeyophwwszzxlaxqksbipwvjojpkqtbfxcumjskdrjaelzxvuyfjwaukmkucdxhczdqkyapplrwwtttntbypdtzpftrksbmseeeceuurnspglitglsxpnwesrwcjxqddukgaecrrugahqtncnktaixubvwmuoqykagkgidzclzlcvygkkzluyfvuehouzofburjcvjggkrkhrqsdrfxsmumsecndrsfllqqgbynmsxvlqnpjsobhlpzpsmslgzwsqoyrnnfhndsdqjolaqulhtazgukoujimzhfownvjqqmizdvbtpmajocrjohfxqtxzanvnjffztqawnerfquqhwhqmqxkgsjfswbihipibfjyvnraflqojzgwpdiwvtdqreyzonhqvsqqhhqpvidghkcynmulfabxgzwvofljydbfmtwhbaoiksjzffkkfnhmofhdluolzqsljpvlpjvbdeaiknvraedpkmsxiikhycvkrqxibujezkplxkezoioawizhrjqrmlbfdaoevzlwjahimnicxyduhedaotrchvhkvxrqxcmievtqjbsgzxcichiqbcskzbuuznnypbgvzzliceqebvmfcxvfzppyrmuszhqrjymiaascgkghhvnkskptahrttnnuvflgdaqdakigwqpeleodrfyrmpmhfzccepkjpcprmxzknrobvegmmffywtgbukdyznkppzidyiqnzeowlvlxasxwmfygpdhptrgisooqyedzkswvpjupbslnxlwnpdckwiuqyigxolyzfuwufrlhlzwiksvbvzltjgjiqrhhffgmcejhxuqitnrgfojdqvyzdkjvbsciakvcpelmycxurqayejbwgcylmhhpcjycutglxrxxvwtmmtntfoplspzexgubpsdlnjwmcwlysfmhyzafqrtihspgylhpfkbsvzgxvrxqwmxxlxcdoxoxpddpqkfvwinthttdmqtjesispmvfkldzqgrgtwbreqlnjesywlhbdptudqcncfpsngbgccaitlverocnblqhcjdgcftemiyaoziseicxvadmqgctrscwegcgnvmagkcwmkrqvtpqvsflahhszjqdrsjhpxhvkluwxlosgdlcxqpyxwsyiiczangplpnxahtaujsaofelxulusdvanzcnmkfzcsyebrevczxsecgcyryqxttksxyhjfilzhsaawxfvwxaydewxcpuykesjebsjmgktymvwjasgaugfyfccwwagdvrhwjtirddrqzobbgjdcqjavlerkhzncquybpjttmkllampgwskmbmjprczybmatiauyjprwcejcqalovvawilnbnmzqabjjbghlxajzeuewvrlqmnowbcxoqyhrzqcbylowlzvrtbpqscghqxdtzdhrboidhmgfxudkvzdocthvvncnkhglmqdogntpazxzvakqbngeinzgddvnmcbzugpctisvhpvcphsruaxdoylrbggpkjoepdjjlbgssdwhkqahrxmhvxaydgoqscuhifstgzoyemirdiyuimbdlbeojsgbwblegdapeqpjcxcfiazqocvzfzprrwsqzfuhjwwnmmyplautcwjqafrgghxadrqcxmjijixvuwmhyhbdfmvftnnaumazgsbfgmnpuknqizyjizmplhxfukhqzjpfbskjfxzzjosspqbarppeyolvbslabdfevpoaopcxfurumuwdjojkcvfdnqdrtkxrbntpevpjrggfdckoquytpdyeucxpoxiqkcfrzuardgygjjubdtuuytauxyklvsbhwjywfznihnqswnubgqvelwziwlwrfzacizyoanyhapczcyakoyqcwrmueinkinosmoiodhyfyaeayhmoheqdwdxankmxzcsmsacvjabhahjaqxrxcjayozaclpblttzmwbjfckneuyhkwyiyhkywmyaxpbkjvjvrneyprlvnmcxiahgkseggegduhodezaxmewdxjbkvdkdgrlqlpwruexqnntsmtrbzpgxbjjyntevnplahjsdnrtaemushmvgdcfelrdamhvzyiafruiendhrpbjypfftjmzwdezqnwrmfttwpedchmtzpfxfmeaxrbvwguotrihwbbutfzvmlrnbwlikpkjilehrzvnsfuqjvmccmxrzqecopkyhwhpiowbpuohblxkijmlxmexeiztamthidyqrvugrkpsvmfexrrxfvukdvddhymsblksieazpptmdyqdshazcwjironbnavqnfjvmlwbbpneqghiphjsftczjpcyrxpecazolvrmnhrdnanckwwpryodqqbjnqosspielcqajjdykscwqzlkzcnruqbijpcbemfroyrzhwxtqcphddtcfgwzyzjhqnjuaqoqohqyeprwrjfuoyztgvufwgomvxivqwoegecmvwinhojvmiqvfkabsonoowleuzkafpmbnxqulzpzkfurruvkliabglhdnrfuisvvpnpcpgbzlwsfsnpfypgecnjrhpmrhjnyxeamldnybhduvubtlkzqxjhgatyjdnhatjogmdfomkkhhncuxckxnsdnldwqsfsmqgselzuymehtsmproaodsssfxqwqxocnxwrkwmkksufkgucwuszoktukjsagievhcmsayekrypdemhcgadxmwtwhlypvekdjxxjxdwocnuizblidofqnyowlnmgtylcxiovmklqxfaxjnfmcmerktnvizdbapgxzusnegddleawrhlvtpofkcasdgwdvcduyvkebnhptknntykpqzuadxtidroyvrutoezsugjpswemxpbnqxpvukdxbrxwkurzyqruzakryqdvfgkxeasykyyorvmcpedqwwmvwynwpssubeuheohrmfhedtiuznkwjzthxidmbvjecflitsbgaimdewxdjkbsjvzidcvgagkelxmesomswyvcwsgfehzneawiftofbbjmyxsqlfikffmcaujeejuijsqonhvoigaieuzpzjbfrohrkqvobrxljpbywzmefonjjobizcpqsyjdphtsyqfkihiegxlnlaxwqafpewixvrcmyvezokjwttczqnmcplyflfxqefpzytlzopyebjcucfvtukxmvxrjfqbjvsiwltvbkvgmekigpebmoyylwrubixkfpubapycztknxuygmchasgaderyhzxthnnkpcjtdedtearkovronzqqfhqmjofqdsaswlmaqrtutmghhzxubpmgxdvgtaywvaqrmctewmypagzhfydiospnxkvqmtohtebfjulfjjulrvtzwyhkqwxnisfvntegahojezonlkyegtdeulomjncshhpudvcddsmhucwhmwlusrymcoaldcfkkwgpslsvdgeziciwywrqnrergfejhkwtgciancvtibusddpcziumbzfjgjvnvrjcvrclwaggdazhdqleafsdgxnohiccbngwelhcnpjqqkzvcmaesshaqupzctdfgkcmxlpmbaetkeooqoskjznbueayzdefpitovkawkhrwlgkdwcqfedgyjiyioepfmiuivwgfdyeqequavmizpqzyzxincxsofoyalfiqdohjedlzptyekzelxoablursjqtwvdmartjxwuxlqxrcxxnwlpxwjopsekobpdbiwmfvjeibccdbzsxnhwlqkclrozsdcwlbktwtxgubizeirdxyzirklcbzdvfgrsjclhxlnumwtrgnudnwnegygjamefuwxdajkzwxtivnbbayepusucsclsopzinxlpixpevioqxquzqapkulmnnzheohmegatqxiuutknschushleewsrlrapgjekpgfffqbalmpdowzjfknjggcsxdhfonretxlzpnbabqfrofavpohwwjqvozbdnujgtuhijiimyoeotgkkwrgscyotyrylnhthdbpplabmqhajokvkdeficvbaobnbijinmaexcijspmdfwysccxmfsnhioxjygunuwsryadqrpvxntpryoddismqijzirvwlrqfrqkjjzegoaxgylldtepjmblvuiticjntbzdkajtojqwhcimxmejafuvbcojezyaaxflxoeoyukhyswygahhfdeghtsosqovqtgnjkbjgothgpfnpouuracytumoncjdxrshduqlijsqyzfnnbjecofxktlxywcvpvcsrvebgyrfyxulagscuzaeunesmgobdswuncvuapbaoxooditzhtgbikuuskywcwsqyomafpbtmpjsxcrgxzjgjdcepacsyukwkwzrnakzrwtqylwwkfcwlecaheufaeencfepfrrynkolxmjirlgesihbobiqiofktkaabtyodobballuytasdhttlejtspdobfoeypuedvhgiuahnabqkxlvbuovltjozaszpmfukoasiabxddpnaaidxyyirizsiruzebtoquiywkyzpnopowslwsvqcuikmelsgfiwbqwxcuzriniymcjixeyzzjmnnxftcprfhodkkcduposbsbmpikpjtbwjadcfuukbkpnwrtrjhjmbnytxligglepnjusdqdecsuymnpxwbjxqkqnxavdnbvbkrtphyvjrpjfcbcyclwsxohupcaedxfpobexzzisprxtszswnqqmezjvdjaiihxykbvmdfeuwenrffpsvihchqxlbztjjthvwehzjmthqhyvoqqkyxofpnsqpobyhivdmddxpyehfdeuvwgtvuakhtcyhdyolutzxwwovdvcibydyewtayektgiamhqzbkzaixofclikminkplgpkmbdukggtwgwihwtgkyjxitjrhwgscxcozgilopgkxcveaqkmqtjznssuqamszriaztlnktzhvulvmvjdrseenyydamyzfgcezprjjrsgndeabnfsgjyvjyyjkwkqfmwgcosnhktwqxyrldltojoxhoitltlshiyjyqyfbsdtrckcfxxwgntpceipxuheehqcyojbimuaqgeydeulrpattikqerxibpmzdvcokyoaeuyjyuuqkulfewwjpvtqkgrpdtfptvqxqqgolcgxwucbqamfxfyhnpztleieayesrmieppbnlfqbicifkipzyoslubrwbvoskxyzobmzhdcphkwttlttblgwozsqvjkhgjgwkuxrzzihlfagqvbuhhqxhknetylbhtzrnwlnvvwhawptsrnbafyhronlmaovtoojkzwivurxqgskzfnamojecxrqzfltvzeibasyujvmrozrvmticcoebfwbmhwkjasmckkyvhkmvlftaydcdrjeyfhkpdwydomfawdvdqkbbrubsxevqnboujajmxjqnvxordlxtxyupuyjteejtfxnqxxdwivkeuyxxluqjunaoljjppskwpxnpwqnfnxjhxgfjdxuxkuoxfxouqyqhwfysxmzkliujrzsuyotjihinhxjzxzivhjoevnpgyjrpkljizetjmcwvbhuyjeuqnkukzltxwkogwzrxemhsofnrnjqwnmmdyinxugxqrnzpnsotevlvdamqjeoyscbqkpqgvnxoayfpswiwrvruvgmemaffcgxpxnvvaujdursmndjgycdukpaxsfeuobllphgrdsuylpkyuvguyjqkbrhtynpmpbagigznyuljlwjhrsbrbsccllvjzlyqoyywgxlhtxqgvcnourgxjkawvxhwkfmyfmwokivdhnkcpzqlqwjzgjveifavkptsbsgncdtjqdlgebrvacwinumwzprlgmdjglxiqqrhvepzgiuilrqylfumwnxccdniqkthcmoxrdxzlthwmzvzgrlchjgjoutegoljbbgsefrszaqlznlghwkohrzvnuatjncmplgvqznpzgdatqgcotqwkrtzmvsxjxlyirvyqlqprvrmlypzthxfzrenmymxvxxfqtegewxvtojeoydhidmjuswirkgmjdszwyfawcxpshvhhyqrddaxvygoiobrrvqqvxqtbqiuzddidtahyagwzokjcnbuktkfrcysuiotnrerlealgghhvsrzhsvsnhzekazginawfepskpdqxlaufruolpgyxifjiepstrqyxhshywawjasotmceeledvjmfpdzjvshuzacyyewhgoxbdbfhmjkjvyokbotygdthfxhdddkjujkxkrgzcsixqxitnbsvelcjikolpywjjiiubqtdidbaclupmmmtzpejztwqtuadckzdbsijvlkawgpjseetticudakzumcwxbbyvljsxtstzketoiojtsdyspxmczkzcnzxbisyektdwyzkiptbiyaaoxpqzbrdpqdqavqehjkehjqqamtikvlavaswbjzsbcicxaifksltdblepfmacxczzvvbexvibgkzgsgqntkqwvwmcjmhiogilelqdgyemkftenltgvkdtgpxrdectnmftxxwfxasjgnptajcyvfrdwqvbvzuilbbiyzpxzjghwwbzfdxakqdggahbzdlmfowfnmdpvlwuhztocqqmgwuowbqyhdmmujtjvwysivmruhgzzynhuiwtlmtsrfgloavlwvegqqanaimzgbhbjduxrppkuwwlytwwoafhtfwtnkuvlbwvgsuxjjkehgpfbnerojyjouedeyysaxngrjgbuqheyylblpsbytkmporwnqoppdxgmdhgvokvowwalrbkkoybeqxtilixogdclnjjdvgsrfufwxrilpjqhjjruuolcunpjyyoufilkcsiajsnbbfkkpchlssnohcxgdoakwnwbggdpyqszwdmnhvyznnowrncudcgcsedykgpiyikunyjuthtiwjeozhkcltedxjbiptsqdckqcwkvffdcriqqrcscvzgvijdacxqfccveyhaepfggnywecqjyrptayyabxqizueetngxclfibdgfhzofqfaseashykpxfvdajjxnveywjedqfuwybyqhbjozvgyadeaonzckdaimgodmkbklbatcljdhrcjvgmjvnlirnqfugkiqnucpwxtkixtabcvjqgeeumxhfednrneejivihpspolpppmygtemntlwapangprnzbijizbypopefcenvlzkekgecitiynvzogizhjxxzodeqkslvrvzecfgmyqklojcwtbdeacdogifqcslvqmzuthgtyrfocjkwmnamqgcyqjoscbpsprmiysbylimotymfmorewwcmfsgjvwdknpunkvoxgclzbzfnqytmwxzcphlmfrwugqksnyqvadvbfcqvcjhziibzsolxfhuozeipcakeehgjlwgoinnsyqsqgdpmnjcopkdrlqwrzeclcizmxofvexnkadynoceephxazvtzzvkcfloezvcfsprvuqijumpjwmlvieuhbglircnsxpxsgpnbhxmdmbninafxhcfkistcwiwuzuoflbiuywxkxmsnnakucremkzqijneijsqutaqsxneuczjpzulblppxrgiatmjcfbyybosydxvfwewxahaozplqxtqsibwncungkggqfbvdisaibawarkspfjhnmecraqxnyfddhygrsibwiawzkpqrayhoejfgzetzkwctxkmrunnenmezdwrduytajzhlfakpxpkubwnwkbaxngxqdqvzqoazphkvhxmgmxcptqldtmdgucyxsvxilzjdgwyptmwhjywfqiijwnrsprqjmpraodduzdlsphzzixeyhoidezyvrofffyftbkpancudkvestksaacgeceavuhcbfkwhuljkngpzbvtwfmxfofmslmpftsgaecjaptkezzgcuzzbnyjedvwohovcidcmhmmyhzeiamkxmlybjhfmeecnsxpacumliajrzqzcclzqxzsghzvndxbvxqvzmjnwmwnnoopraohzobfxbckealaxexysjlpvkciytartobuecbddeokebmdhjdaurprdtcbmcvhswdzyfcejqopucubnxbiqsztobvcdsmyopxmuzsfsiumkonyoriejhyzlvcqnoobdnpynkdhsatfqidebllnulmfgoyvcmyiapgpzlwsnrzebckfpvslietovrlzfjhhbnyabuuonturxfwocqalutbrmnrtyybzozcpwwflsacphaejqewnzyennvgnwhnkjrbfngshivxrxbdohzbixhxkddyznnlwgmdtuvdfsawqdzembhuyorltwlujafhgrkboietaerqjrwvsfrsukfnhqisspayhmcvugqxnhpwaouutlnpwudflnxfczglmiiioyfdgxcilwdejqufkzmxokfsllextoijppnxmrfxnicwayenxqkncpfoclnvaxfpnumznrxacbycbepaxcnbtsrwghrgeyxrulrheojgrklsqasnehrybiuhpnpuoolizesgudolnzfgcztggmeivapkohgcvumvygdtkrezrmftlbbsngckgrxwadawzptyvwrhnxjgjobvrdphlrttkqslwshvhatfymmnkvutmxqfcfmnwijjybuutbsddlkbywqiukdikunmbccakljimdfhgxmlkwmivespryxbumnvorvacgjqjqyrnmczjqievctmasnwecsvupvyygpjwpblbdlmwvqrxlfafuwmyqhuictgjkpfbsteyeruzjnyvsacoxompvjzychjozoprhtpnmlmwyntsnvimkxehgdhklqymhpdqkvexgsvhfobvjkhvhlfnpmzcdxokotcyqgxzbsgigjdsvlpewutnjsrmrhyfdagtjfskyasgmwahjqmhmfxvaojryjxbmfwvkphirbrdzrnijzqygnvgdfydqxeccdzmuivlkorjfeurfkplzkuersiiromtroflwczgqqsyumpzyemzogdianqreemvsujrwkxparnwfexdileysiguxyobfazxukotuokwhzsndrsncxlwhuteuhgzjhzgrpzlflhnkbcnuuayrnxajqfeznfkugqlwrwbcfqogsbcndagrxhapogobobxutislgwplmetfhvulxaevjgkxpbadcxzvfuinqaacgtjnqfaoielrlvrayrfapgywaikqimvoigeymgoulblyzcaxwhalnajoitgribhqinouufqhgbfhgffcmfpbhyppuwiczqshfidzptgyxnffskjgrykywzqsxyuxqogwxmvohemgrslmeuuyuewtgoldnicdwlzvxxmgbynusagxxdvrhtkniytvgvaegacfzomcobwhbfeaibsruchccazixapectldhzfvadcekieujyoedvifvkqsmfyoykthlaeofjsqrymbxahavrhsbxnneldexwnjwsxcbruurivqjesgwabxzonebqkbnymlqlptejnvslmdrelngongcckgswjhuvtmgifmuvhoivrzaepitcoxgafyxogrjberlldfgnvqioqktftojhlpirphfxyryekmsotadprldhyworkxayokpdrwbspbyanqqjrtyigbpeafxkcakqmbveyyypawppnhyeawojafpakpmmpxebybhyahocefrtnsxpqnaqssqchfqycubcxldxsrzwytpnnofdbhutzmxgrngvjiahtdgnwikubbkosptvynrycogvcntnxtwswdfslrmovyenpxionzmpoumshfhgyeauhgmuzbiuzojplsfyttpjncdxhldgpecympsnscirsridlpefivqwxuthfypuerusiogasoukhepvutccpsyomtvrumnygjtoxzrpplbyprtjmvodqmscipwecleivxyuwpmnanmsgfdvdrytgsxoivumhywewwyummiocugkbkfedezjwzzgutubssfopgibusrwmahommupswzrvyzpsutmmaadikgddyzryihmxebpaagxbgovchhqkhustavyaxqyhxkebowdqearkpmoytficbdybawczmchmplpfhtvmtnykbplxwtzxyzazweykhfwytmdchaqcnrnriyoetnbunbtlgrvpzupuiuwruptkgiboipucevwtyregkcvjymfigczbtslzbmpjdjnhglbgcfnpjkyhxgpfioibjvcmjtvmelumwvsbchqmsqvrwnwgdhjmcnymgwymhsadptguawiupdnnskuwrdkttlhzhgoqaovsjcmmauirzwfuizqbecwxnezwkpmmdiepmqdmmleohjirkysocpmqtnmfcbrhjwwvobjdnnrwyzoizgxbxltqaivcjnjulipzjyeyovxmulxvtwzrhsjhaflluufheuiqvnolilxfywcusbnzwwiydvkzspgwmpmjcdumqtrrqunixaktyuseqcditkefbtqfykrogjfwfuecwqwvlobbsellqprtkjyiuqzabeygbekxvgsiwvloawasntmyckiyahaboyjpdumachibctpeprxemjcrvlrwssziqlxvhmxjtfkxaccrvzwikybflsdgkfodsoazayktdxqgzuxwttefuflhaqpkxgnpuqouobptyhzzexvxscfmjswjiluirjxlzohppyjniimmfjlalqmviigtucbnoyzpmifdhoqpwebeqoebfsynbhixjjmxklnwuscdisuezxkplosqhtgkaojjyvhijwgfqiiydeccbntmdldmelwezhqzfxjovqvlafjfjnjkacwgqbsuorboarpfqzvlrqyrvhzeuiqxlpdbqvxfoyvprkujjsucisugbvkwdbtoqyrivrpkrmbjzvsipplyjheneqjhteyleruzillaymlxkfhzuuzgddthuerpkpbogvppidripcfbhpbelamrghyclprxgsnnpceyfvgxzoygfbmqcyjkfimszdpiycxnhbnoywnxkmfrpsjrqtbwdpqetgmrkjgrmuikqvhcjpvzhesxzwvclmjguvzehgytagesdnwncrolxgjxcgboukwqgwvpctieboygcutgljskqdhuljiivhyddtshoblrpjytftcqdwcvbkpmvawqhvukqorhpeahpacuugmzeowfyluvnqounkgeyznqfnzuodokkalorhwruqniibewllclmpbseamsedeqfpgwycotudddghbtsdehuizyintoqzeypnuppkikpnpvvqopvvwrdxrnlmedmibdvysnkdzaqoxngmddjzumxnbkafnmqrrnrjabozbfpzsvnxyyxukwiniktxwjopwfyzjpamuqnoncomanimjqatatqyefncmodvdeizwxpjadxaqgnbwnuzilzmspqeduciamjwjahjefkwlxyjmukuhkizzygeukmwwxshxarbfdascabouoieysfxslbnxpjtmebjgunnxnfbnipjwzpwrvvjgyygnkzbqcnwyalxpsyeanpzofxfatrirrohdqituvrtxcqoursxgkyvpvcrovzinqpsgzmaxfvwkoleffdlpbiezlxpgxxvnmovocxljvhtjsaqydbphkwgxtvfqtbfhrcvvciexqygkywkdzaklysirookjrrsiuqdwyjvqhddhbnlapxonqyfgorpfijpczuayexqnatvbjieyfsovqvbfmsmwcczbybbczuqznndyvhzaznyrkbyywnuaptdnxfsybizoxcpsloumbsenwelsrfsibvyycqyfaxwxclrnzlacggpckawcfqkgnkgsaexaetzgeqtdcvfibummwkqcackpnrhnxfqbyrjfidimaqwcmiojselugvjvorjmybpyszdaeooegkgsuwbocoilmugcnpqlsgjlhpnlfcrloadjwhxzxiklesoriecamnntebejfwutyacujcvgmhuqakhiolkbaawfbbqgzlzxnetwipewwymwkvgzitcktyrwbiecvdbijvgtkkpildhvapwkiaxdbozcydhtjidudlqpyhallhgnwfahhxminmnmruhcenzkypzwwbhjiqzhxzoeyaplocxiyhmeulosaorzrykaqjjnkzuibjuqntancmrwygrawkbnkmnbvyqixkqzvmpkirxkdpjdvagtmhgwvwxtuqbscrrygikoziyexjkulspxzvuxrtqojrgmkzmqjygkgfqfqabcsqzumtrfnjvyabmmcaflzlvfsmnjooljhkdvewatfwrhzetegypfmnnebanpqyaxjdspbvkgtbpuhlyqjqvxdicgkpxbqyabbvsdscllfbfpmgfxwaxblzhxqeaicbjgydlqfyblbicnohnkjklulusdzumdvvjvzwlgvotwxvmncbymnliygcbhxnkulwqmsdsnsompjycmzcaoqkmynpfmfrgsnyegcyvumhlyhpkismwiwkglanxfegxsedaidxcshnqofaxxovhkgpwgcvngbmagraouytmficvneumuqthwifekattchtkywauwtjbenyrsteolzvjkapwbipfrlrrhrldnwgrkekezqskqqtcqiytsoajbrcijonymvpwbbcbsvnkljmdtkxmazxbralcqaacvrbzsdamapwnyktuxsgzrfdifokxrmcmdflwknilfhaftvzqnhsfnvpujcuaowpsbcqlsayxhbcdwctkjlryiitskpuzlltoojbgjadtdhwzlrlxfevnnqhzfeasptgdeilqkqlnyhojacghicvvuexcixuyrbdxjpnvfyifhypkavrlzoiwvfyddsdwvhtgyjbfjlltkcdmzwxbngxilxnqprolairatthcesxqwadwzcxmiwwwtjoicdvcnpegkmkqgihdkmzjoyxzuvxnflxhqtmdkqlucwkjgroqfnculbvhxsueftlwozbyqnsulffrwtjeilyvptcmnyqssdqgdsfvhzrsezlduuhdihyxcdjpbbjteaajuhebiyvnxgsrazuigvhiyqzbtivykxjegohooeblmtcnuzxcwhkuzlxtusterclxsumgbprnlwchvckrjwniikbcfwiwzvwtsiatztimplumnefyaugihkmmixkjugdmqdhqyseodycsckqfeypnkebvbmexuhklmtdlljbqidkmncrudjhnnjiqxnntwzgjtlugvvzdajpqmjmpstehepxdekxakdjfpfnmampdwgtkphbjafqhwpmaalbkrmriseuurjzprubjbcuejnngczgcljoeyhmqmgmfrmwiixtkbookbbsdczinkwriefaslpxedvnlsivtwjfxmydpzleljyupduhrlgvobkavtvqrhwrvwukxfriqpcguzpnkyjbbvbxqynihlzdjtpgagpqxtyuuqhhoqipojoehempplubgjhgqyzpuzjorrvhjfxxoncyrqpjcjkkuttksscotlclcasofrlwhpwyglhkwtuqnndhhfvbqzovbijhaufjmbhsmrcikwazkdgriduzdiwerfntbscntlfhejrrgsqsvzjgcgfhodohidcjygztugbyqspwmgqihbolhvvyajhioktmssgmzjlpdcnqkdareqdmnymnjtvzfqmyjukkdxbgaqyktyezohnbhzqsvlracfynzlzeiankslxlmbmckaerbujwicxmixbjiaorcdduqahcdvfnvlgzhrxruudcsgncibvmgzixbpzhlewirdjzwhqqdwuxciallvzswipyzqfmvbxmggndpevtcsqecsrnorhkbwkaprnkvkybsogisebuwtaymuncnxoovzokqdulnvpgjxodbrzxmbxavnciktwfsnqkqmygjpmsmcxovynjankvamekhcrzphmiumofbcypgxfbwtkygwtilzuselutvgdrurwvtwmzuscslpqtlldwlxprkjkfrqwlhtidpuelmhfzyvsjjviuuznfkzkbpjoxewavqghdnmcnkxztuhppicwsbitrrjqvfsrxyacoohbyeatajkprmnjqwejnnblutcsteuhsblthnmixxzqlnadjgoywpjqknkerhnmkafsotclsddgqdjbmaakplcabnguuvggwnykhcxzgafwgraurceingkqtslporwkfwwozvnfxvdfofzhhdpxmcnhuyzisxuztsnuncblzhqnmsuwxmtjoitihstbpnakgpfvrigrpzectbyqptcdbvnkpgleunoccvxuegntfrxauxsjquourcegksmefbikygeemratkxthxlspihjzlqiviucpxkzwqfaeyaxlassxgkoqtypeoxcyuenropphwsnvuniufatnmidiivoyuqyounilcxuzphwkuegcgcpumveuqtumlsbgfltiipjawhmtlsvtumngjucbnwoyorgucbekqpmpwykjrhcntrwflygyxwznnhjpjnczeoqanajghltdfpiqqqrpnscazmsibukgkagxdsfkfzpkqzdiquxdmafnmzwpvgvgieflwlybmpocprlflikzkrmyrkomsjsbnaollonzebbtsoyfzkgjbuisfwhxhbaxbpiofxnjareufebeohqqeykjwrif".to_owned(); + let t = "tjcwallfkarlrvfxchdqqtiutvfpoovjxzgxmtextvintpmvypnplyletrwhftreszdhshenfocadoxegkvrigxbzvleqckjdnsvvwkckncpdztjloauxaxwvibmmlxpbpmwnzaxmcopdiboydkvdisbqvpfiowjfjhsihrwlfnopodosnjxxdyqynvhbrqgcyamhrktzyhoomcgcoezrerssozvipekpezxyjqxjzlymqeqgkrzpjrjxqgfimszrtwrcoqmqbketqubbnbswsbwljdvwxupqtgtjwhzztdvjzwmnzglsjjftnapkwedpmybkfalyggjffyueegyopfhefyreeuvsswczznxfwimbghhlpgbelklticxoyugsrkrqzqxvyjyhqiufqvmdfzwpdvddqlvjvozwewuehslyahfsctwjsuyxsdaiqvtnlskpqewxyjxzrfttypftkdqcjtmzofnczxrrbpqzboastuntlsovyhxhalgqqtsrsmivbzxcnzwivkdhesccbcjbnsrelmvgygbbfyguyeetohavbfxehjfwbzconaulgwolwwhwblsruumyzmcivkfylhmyhjlphbadyjczwusrohrotvyqfdosncqwldmsfoyfyaeuuynifeyyaxqhcgaplsmywardorimtohnmuxsbysdxlkzrmrehfdffwitnqigepvslumoshrpserlsiqzpteupmneexkkmhdabrquyilqocegmuibpmxgbnkhkwszdxzeorapbmhpqlydhggyueevrqfdmxcrwdwmvwdwklmbykeismgmqnkjdpnqopjmtfyqeemopapnmvveierardkuuzmiqwwldwbhaowpqnfdjchrgarxfduzeihvedikakraapsqdxtmzdfidyfjebiiksfqxoazaucajusotmcuphcuikfmlqwxkcohsqhsmluyfmmaypupyzmgjtuwjrutvkdncmhpxbnenzeoqafrztxknuhwldsinxxpjegihtmwvsmnsseuneeaynzlqttdqqvzwbhdxvbupohjimdvskyqxxdosytioqjmusrrpsleiunsiroadosanxqfvknlcyxwqqpflcltxymfrciuscxfankvzzhcxgypxqwishdpfrxztftljqsjgcfhdmjcskrpapzswdkeujdqoydzryjxaoegcqiuccmcrnwosiunrzfhxkhoiqnlgurikzemdqqvgolyxfnqesydfhspxhadbtnntrzwkrtqgeoflcvrwvvdcptbwteanrnilpgvgalogbtsfrlcmifpxaswuzyjsltdazyjblxintcskpwwyenxeitahtjzfcdhebqfpqpcjtutltrjxhgbpccwvnxcsakwecdtuvvdqrybkskhbtlqvposclvwohusjalevijnbkrmcdvdwgvtxlmayhymotgztrfqbrddbwrfamkwvfqsseuqltfbolahfizgzelabehbtrzoyriqvfiianjozmxewwkvayxdceevvelvvwlrbtzbhlrgzomvmwqowpsbtwwqcknygyrjtsmcfdketwbhvrvripsdorvqbiqjgjsceeejjpqclrjglgatwsxklscmbvxjeplkvquehmgsdrzoyzkwthifbmtehtooibyerukygrtkkuaivkgotovvbrzkkpyurzaktljaeemoymztzfjswfpzyrjkgiezhfkcsvcwzomxblsatbupgkogdzqjjvlscvvwsxurogqpsirnjncsxsycrrmbozvsuqomoifcoxtifmvqzzkzrlblcpoqojikayyqgduuanfhbaacakbtvfezwurlezxgxwwfzqccfhlihlkjyodvtjvpemckoasnwotxgvbncnvlahxyvauqlrgrfkbtktjijeirzjgdydqzlnzgptxbmfsspwncrwmdcuudgdiegzdrodaeyzhngbfxxuzrtouviqzothvaiatxdvdewkrclyalsbclpyhaoiqkpnmaohxtdaxbmqexogkjjmwbmdbbntndhzfviconeopqgtpxbagkmclbioevkrarsfoajeonuddbytyzvejhixkqloovfoozweaflqtfvygttguomfyvcinqxdleuceqggxrysztrfomoibcnbzsjniisvpmxvcgbcxzuwsnegauqdwfgwxrlfcddrqcmuinwiotgigkqiggndlvblnmsppvghyucgjaqxtxfchxmqfctqxudkiwbxtjfrdjamlqjhnqjxnxpsbilzeqlomplgyszcdbopuawjshiigxcihpjngwbslnakhaondecxeahzjphpnjzwzikfhlzsacekeuxhzzfdboekflbuxbrwlbdsoenpgtzkowsnxzsypxkuilpfmgdyjisxnfmvzngnjacibugqrsmaebhqjlquvlsisggrumgfoiorfwjwpvyvzilkvefqpxbhfhbzvjfjuvcztlviiwdherszxzpowqvbxydukkdehhdaualdyomchgdgftublsflqkfculgbulbpmmsmdepmnstsnnwbhboynvchijkdunsiamvfsmtfgmywcuzjxnjkkmttxdwrqqcscxzwltcrhcnjwmvvbefmsafpddjvvlqzkpvvixoszebxqysufzgxznpesycnjsmvhhqshekiingboaxtafsbshikfkzqcllludddkpmufuxtuumwzearoidvseowrbhmfnprcdljxjcufqsfxsynceiwiwsayaofnfwrjjdiufcayxfxpfkujsqsrjurliwynuryduhaclackhzcmlwwfmqwvkngulgjfailwrlyenapubrimpgsbwqziehepqoxqyimrtnxinoerfmdutxyroxcuggjwwgmuqbnloltdzxuhkadfxbynaahhjtffbsasvpdjazoawjjilmnkqmyqohzxafdezfwuubfxatxzeghruvckjcdzjcxmjcqijoefrjcsfztlhadexfoijriswhgflyquouzggcaldtwntbrrihzrbjmxqsedtuxhpznvdpiiigxeiqvqywkziwyaocejxdrocgjhwtsezpijgfcgemhmifmyjqiiwbwahhidaakcrsnzapfedmqltemfxwntxktgtdkufuyxolwodesgsksopgtmcghbsahoetklpiievhsylnffxztmfmajvhmpkvdopnbevkirtdrgqwlnvfccrclomzewvhmmvnqszblsedywbkjxrlbkqpzeodajmovjboebrpvvuwrwgcvzqwjilimcnonaclldzpgshenbagzikuhatqigbwiokyqmjesktacaereezfojavkvoubprmdbkwqvakhvkjyrccxbhmkjjuexpimiwsliqbdqnknavlrxpqyxeiiofplwzaevurdkticiupipdbossorwyamdrabqchlwzqiuakcwblnembxgpofpqrvhtwxvekrfcbzenbaponvdqulhjqxbksjdogbutuzxwacjecysswxiqjqbbndlfmrvussnmtliupuyrusjqqshbkicxloezhbuztjlnuwjjshdmbodtgmuqwxpinvjuxdvqnifjgovyxalboquxcpnyofidaszxxuqkcxwjorhntuohkjemaunqzxtbpsznorzqoxbeqlsjfgrqrverprjqpcsgwtvkmxdauehlpzuvhnnzlrsclctcgnkdggpsfsuzxdmocjlmyyljsfmdjhhqurvczkwefsgcwusydemcezlyfzdqgkiacdcdqaivtqzpktpoxcsebfcifgznqhounsydtiamybdiusyuusyyacgfifubnivcdvfyfhmdipoejoyejwejzkqjqkkfvihyfoylvkqfbgjkxiqgguphfftxpdemnnktbkeyuwfxdoiayaghxxqeejbvnfiauuvvfbvbyazdojfplnwikmmowpjlwtnqolltmgwmgvpxgumshkctyphwethboxrcifxuluhurytathucrwwrlfosyxtnumrcrrzflibegugbbaeuxalihbagzvvtioybfzgshhzpbftegxafzmngpqoonlkxaizfhfaqnzhqeaxmzxrylhhbzvpmjzmjjlqsqqifrsywsvksscselzfkxuygwkrfvjyocivtatrvocnhghnrhsdgobomohsjqszucvofqhafjporwbkfvnllrbyfisqbmsvonltdttkekayhdimawampbmumempsemgrycxtxjximvppedqcfcrjonxuzmmeyuxywwruipeumvjqyzuednptcmpcybiyyfxueoqmfugsrpkqrhwwunqxzhbxjlxjsufwlwiqsqkkivcbcaxynpxoxalilirefwaqulipdtblqfmufmuubsiauvigfbmmaocubnjfgksyphswtmswgazdxhjflxrllufnjrupdmpvvhrovmneomhmvsrgpircezrnqlevavqvckmawzeknnyifrrwaiygjqwbdcxfynbcxpevoigdxgncyeyapzgyreaujxahmdlmsqhiaplywycwdbwuaestlunutpdgsoumgdujtfhrgjplmlfopzhauxwnmzvhqptwtqfovofdauoohvfyvmbplxeaxahnpclistwqhdtjzkyihdhcritdhydgamvpohahayxjesvdetomyvorfkuokzvknqzczblbaknecijjbxvbulszvpqholrcdtgdurgudtahbkqehlfczydwptefgvjkqpplivhlritsslxzxedyejutcyzjwivmamzijhwaprvhcuibaozfxwazubksmhfmvewfluhclelqyutzkvghrginivgucliareffbohottetnauzvcgmloztjfposzokfvpglyvgrbagbwfwzlkkcmfltwbmvpycmpjyngehhgnjfvheisqkgxyztznqrnsfcddsjkbtsqcxlldudtelsellgydxmycqbiknungoekmpvplblsmfwzrcywbmugeyqrnmevaihmacelfrfuwctpgtoifkqmigdxshussbhsgnflelfcnbsvugfcqvobdtaxcvsuwbmcosqsdxwsyoptwvxpsnsygsvippdmqrqeliyqgvkglazkvyzplrnrllcbafnryfxkoyawvlcgnesicrzoknhwyjxaqmtptrzhrbfmoiubonlqglgraqpyzmysashtlidcliqasmdgbpzicfbcvqcxecpeuyxhialtldvdqzkrqjbuqcwosanwceazcaikcufnxbrpadhsokmgnkuhkjeongnpiwblshyrirhkwqcmaqtnapvmzbamjqesmffgofxyzeivumixedkeshsrkvgulkozrvfgacezhpxdbhagknmewhwhccdnotmfotnqvsqehpkkwksgzfkyoifqmkdcfrivkvlhpdmwswjoibwkijiwrpmgbrigisbuomcfqqcimnzwovgzeqvyfkggbqomjpizemewcigqvfnmdvljmijtspcwgqkpiuomhuijdocywpmzmxiaiswajyypokgwfwkorsxujzsfqfgfeohmidpsbpjsaqqhmbvdtuxewsjozptfgbuqejiiasaaiqjwreanzztxtfluwfaciutofdwfvyifrrckyezzdtwzyhtuotxypsnuvlctmkydbcnbgnamiwngegaucztrtiopvqkhaikdnafvpfjxewdkdfeffzyyhmpdezkgkxkzzruoyencasmfxtkeslfazwfeyrkkowjpndfohsqkmfpmycsqnxsmwxsurdefbpxrscfcxxmjcdvcfovunnjlnbheenlickzvnezkbnvgqriyhfuwtdiifpolfbthmsezydlasgijzsjgyddthndmerxjutrglvhkbsmtbweaopjotohcbkqhdpraikguhqgikselokoeaxtvncxqpnxueounabjitpsdjypxjfdlcygpbdfssemwvhjvkufdjagsyxrjcxugvaxwfeqxldwgkhbwcjzljhghhztlwnusorqtyhtjkppwwsuydvmmcswlrpxqetiskaokhhvtymruhlvkghzlbvwumvkqoulbvzneijygvpccbxnjemuhjtcxompfjagebtijcirayucbrrkwdfdoyhnowdtfdzlfvtqzcizcccdttnrzuxpsgdjcgchjesqzohasrautezoxmiyjhqbntkqzpzktudukmucduyyyxoylwyufoythklizmvsiamsmhwrdurerfcdeczjrxeairlhgicoiojwxfndcehvllapnabgxhjfbunherxmfgkfoxiqdrlocmgrmjylqhrtdgcjxaxeihlygvojmczqqfieqgpjpicuqfdphcupjhopdeyriziyfqexyugneljvqokzqgqzogqtlokvpswukauiwaxblgydwicmrtnhzdamtkijfefpgzydcxepgetcoxrfsgmummgfzqqgwyvdzvgbtmrzsmdglumebaynpguoxnwvlrykngoiuhjmvmvgjjkmjkbyrvoqkklvemituwbrfmfayaghjtvvdwtuukkewycamkvgiwznifnjhtsrmomsmhmgtzlqznslzothmvuxahijcaarqojdyxjrwwjxleiksetgzndbwlkbonseddhbatvzrgwdkhpeljlmyonvczwqoqustevtzssqzrvlynqjwbxurmrvlplafiuyopupkohjfdwdsmooplkjxcelrsnzcjzqythkiovptstlejbwxmfwqlhjdwkhfkzgdgqnvmfqeackjdggrndjzmteldmqplytspipdnfhpjtzpchgpmqqblvmqjcgubboslfvbleqwzplbzstlkjmxgynpdvmgwaakgxltdbpcrdesvzdhisepstexpqdntfxzciufklkdoqvlpasxswmlqtihlouevufaczfonrrbhonyphwhgkuwfffrvbvqvbqacyoppitzwixnpvvvirtnwygrcckxfaxjaozswurucqitofrwyklvlsonwymdbkmbantyhmsldcfrjwpiiafvutisuxvvjiyjxshfebsjgxcpvrzguebqamjujersopbmhktonlztlcjivkoppqgpcrjlvafmriazstpfgobtsmcowqdlilckclxancmfmogehxmplnjeznuvdxjojlynzynmcztpnbtwyhomwzsvmmtrlefupgkoexdgzyvoarlyybmvaesoqnhcrpyhvixbichhbfvbwibwjotlumbnbjptypcvazwicdpdkmggvjdezwsukthmeyfenjzpivzmborlbzuyjzeivwcisluwjbdzmcouaojdeaqhakfljkthiypcjlztoesagiwiyhlfkcmmouxygqfqowtajutzynbexxpwhabrepdtlatrsakjwdjhxcgvrhbogsmntpezfjuqjnkenunlzwswyytrhwfqpsdkhkjotehfttjhpwuosnmsnfjxbqnskqcscmgyspdniouxmplgexatelqgbdymudgyrmwjebympvkdmxjqvjjzuahwdikzlqacewniylvpghtseckboudiwkgbsqdfidhnbwxziurqbmjiovjcronnzvrtmubwzilahjcpfthjfsrvocafrpvskmnyiovhzijgrlxxgeinxzlndnswcnoozenhskqrsaxmnwlubtjaswnxjfunvkcuopejbwatwafmwqizjrzdomdzuznplplcgplhmncknkwmaelmynrozunvtckfrwjznuibhlmxvklxrwlpjddlxsgtvtaopjoefwgojslgewevvpkguprukanftptkajofiuvrohytfeqctdjoscicexjzofjooavwwqqnzoifsyjnbsdwvlazkmbyrmofmlelcuybkiicgsrkmvijikjtwmtnykvlvbyxxwbheljmfcysxgbgrmbpyufxgckcdibagehmqsaxuzpuhtaahbqgxxfezriebjejqnvghvfdwvxeqzexcwfatmgufqygbeprtmxaidggafksfrrjpxjllrfrhgxlkpcebcglhoshuebbvsknrwydpfuzltkwimcmoixvxpetufurygepeeuukqtxkdturvgggebfviypnujncnfhubbeswbcbxysufyclchgkhyzdhpgwwpqxswpoarpxsjtxiwkmdsynqxszoyykpqihnxxnromjyfiidsujkswdroeipcsevaoialxtalcasmiwgefsybvprcxgesnbudjuoinqtrsmfailenecqbuhdtqklflgixcwfspzlhnrkxeqkivckplpkbzwgneokinpaeqonffxcjqoulqgacvkfximkocuzplbvcpjhwimgyacjrilvdyaagokxrgwiszeuppdlxptwsxhjftglrgnzvyyogwwywaunraappunhruszpykghxiexgsefoebrzoizozqkmaejufyvpfcopgmxascqwdjxtswktpwgpapjfpewuinlqbjqtlhrrqpmknygcvmrxddfsjbpsociplbkzicsatengdtlahexkhcetgvlwyvojwykgccjxjwgmrroyxlkfqqyymlukgivdjglliultqrhjkvhhjtozkoxyztiicfnllyywtlplcxvmuewdykckzbiavsizxvmlumjnyaaazvpualxaxcmwfuxaofzndnyxajmykmyjkpfmcfoahawmwvpmdqzgeafejtcthcfrumfwrtwyvvnrsedxuffyfkeofgknlrghdmdvhcvdzkwrocrjhwjmjocowmbjfkqjwwgfydixohqejjpqgzeppgdlvhxarnlpjtujzfipobtxkjpqivhzdlkyujbnxoeikasjfaytdrsochgmeolizygvhjieampkmhvujtpnmidrrjdwxpeynmvuydbyrqkgzfakyrzmbcdtohrnyvmljhhhnkhgarmbwomwilljqocextrvqficnslcctkdkxejnqhvesfuhjygfrcxxmzmelohgamsxqbnjjipbpjkbjrgavdxhfjmsztyafqzxuoifzxgoitprkxshdroidacevcgcsicowktvkcmsvbkhbeoeveoahqfesnhmvldsxwphabaxfmegsukpzaqiqxmkktyigbaeaplatnyybeetbqjcqbkgywsksqsyuueumswfhwdjbheczpgpqqxqmpbghvhdqlzcdwjlsmwvvazuqfjivgbkxcsgzzkrljtqhebcqxxlaxhsesaaybmxfeeheqyrbuhlylnpkkckjmcoefqdgccogivmytdcnnnoyadimhtytxoycedlihboqwdqrgshthvthacwjxuduidzoikwpnmflpwcwqlryinhkpdumzzihehvmttbggjrvfwtxjnvsadepiydizlrdvppoitvocokjkfgwscoshsjptmzuaryvgplokgdmxpvjuefpivjpqtgjhgdhxdefvqtfyysvpphmtmbbiksyfzjnhowesdlntestfmrucygvkjzuwrubqdozunfmqqblvvecivwktfhgoicmaxosceswrxkjqlulhznrwldsskyjvcvvbjneohchhntxankjozalkdddqdolfjihtxnjfrsogllhzvspwtagyflqizdqllzejmpqfhemvrvwonlkimsjrgzchdssqrybfnrkxxwsorochzopnhyhnajudbnvunxzbolyoisebijijxazeygtypqdsfbmsyltowtcgnhkxsshpugwvmptdhzvmahhauaoqwtzlajjsdsjyyftmxorepmtpvaprcgjaziobrxvxpexpmqdjgupwiknfkfwplfrmqfnjcigtmdkavnjcjbytlnayswpfegrumedqommdpwdlkpnvqnrdarbvqsauzuqnytdpfrsxovkakxvcmm".to_owned(); + + let expected : String = "sehoeyslmrsxseyxdkpnanapjjfophmhnwxswpdijxhbbiyhspwudwlofsewztdprchnsmxbkhenpcujuqdxoqntjspkluzcxirrvouhvyukcptwhytwpjrybjiofksesjvnzpuvnrhqidmpbinsrhsusbixlccflztmppjegruoujgxrvqkckgulquysyefxzrmqbrxunnqwtnprfbtqhqdxmerkkwjloybrraleobdjquayywqfovfazymlvvwlvacmaptoswaksciqyyymwfmvdajywflrfpggezwyvyjpbrgzsgoolclodupzcasjqyruxovuoempvurpahfljtbmpqnrtibjgsfgiaczeqqckjtkqzxauzojrcdkkgtsabajbfkivakikfscgscattmkvpvhvqbvtcgvjqfetrofwhhdbmfufrecgbjdumbnohkxapevguafbjiexnyehdipgttcguqudcufsaaaucfyopcnfdsmiadowwrcsjyylsdfugirkppyftmmwgaeidvecogwzfukzaswgcnqreryzfmwlmcvszcuniqmplzrltntvcjogcpfhbduqiqihscvcujuhilubanyczpibepjhvdxdvhkplhsgronbzidzxdbwslyycjixofckpnbawvgpjwrigwjdzmauzauclcbzkelztnzpkifugyemuopvcrrctmgeqhgalrbegdurlbntzrftfwqkoimhwsomzuplnqrwtlngoazntgizdbjrjxahpqtqkidybvwwijfxlemenxfqyqhjpjsganxmwamzxivgtafehtlwqsmqlvbaethghgtfgfggodmjetqnmbjdvxvgsxjyssfbyaigfomvsyfyrvneyyjvvgenfnlyhsbfsklayyxsyeqsbdyzbhxypbnvqztxtwemgpohplzqqqirvgtzpqxetlzlmukfrotxfhevvgnlwvetdzssrsykdyxruhylvslbbrywxljvioplnhfhzdredpxyywluoyxrqxqpkzlspcffjkmlnfrrwprvlcrbboutnkixkvrbxwgjgswvanowefrpkksnaninxqmjodlnbrwjmuhokvkodegpoycpnkelcrwswhgybejpzqdjmpxrtfgkekbrwfeyydrvmzvpdeeevjnjznausgeysfsonymlbfiqgdfmimqdvgmwvorpwxooficsiqfmyocerhqzvjerpsnmigbeersjzwdiniulwyrohkpdtwukqjwzsxdwpyhqukahsuurumhcwyfrubbnmxmeurclpjckvctozqftcoxamcthfuusriynzbbrkddghwwgmdcqrzsdelmlhidaqeosfrjrwozdmxmbaqttrmxxzljhuohmsxexoprkdqqsoctqsmkjyjhaushqgqdzohyezppeghwwjpmdeyoehxeepnuwexvuhvyilpmtwlrhcfkgezllwrrmfmkllhfscdcpvpircbzehlllmyyjpqxwejhpqmkssmkndugfwhkdtxofvmqmepjiyqaodkjvytkcpqhlytorqcylrpaxejifzitesebszlupceaaxrtovrbmgbmnmuumcpswuuovflmhppjmgccbugqcjcrwwlkabcyxwmuezhnowxdczhfvnvazztvxfhzijxhimbmlizcgyfkamqvcnxbpryoyfogqlpazqmlbonhosuogkmkzjnqanfauvglgvlgoatpqgyeastiefvgqiwtwdtqycdhzrpnriejqdnqxiacpvkgggbcmuukyaryrgnkqutgzgywpzagwkmctngfkdpkdjiupyeisxorfnpwoqdmarpthxytaqdfzozqmfygenzkcoisgnejfveotfhvvkbwacmmknuocvaemjwswcddyirtnaqiltglwsaghwwjsxneglyeqckokbjzczjptpcrjexrbtatsqzadxftzrjluskwstnniseswbjxwlspbtpfrwasnkgicqgwmwjwonqkqbknneeqyvxruyljirtmkcjwysuoilyymknzptqppngllruvloivqttqnnevyewlpjmgdexusfffwzdjpnefgzxvnbrngpaxypfdtcxnhevfgypvnvdvxaqkejzkycjzrockscyzgtgotxkgtndqptctfdfdfocwehjwlhxtceixdsfyhiqwbssgyxmdmqcsxlpiumcwsktweawlinjjfbsfbglpwnhuaweulisfundynalvnvguyaazglofayzcufwhqqnkfslsswphtxcuyevgrmlrkmteurokjbuotfioezvxwxtwbpfsbqllfgrbzflkghycpisthnsenmcqdhleayphfgigmvrucryraqmjghpvvsnybycbztkebsmnnfkqxkjzdyilhagcstctugxtzhzcalsptchqotrrrbcabictegpymotnvspxfhnylwqaphtgjwgkgkgksvkejdtgxledstdgpuifbbnmxwxgidsbadhjibrimvngqqmikwnoycaxyzdjcwkebtpluhtiegrvzfdjcszauaxvzdeezqicjynghjqlrhgqnlcpddpadovfrblstvucvikctbokiwdvihmlkbnosivjlicedwjzgtdzwrmforcyypliszykhvuvdyzhuiideleafsftjkrhbcqtdqelmagpyhyuqixuwcwbuewgonnprfivwoikoqbozajpkilgkihhodncsctmidjgstqijtzitiagqnmdxumlzbpsdignmpvginqthpdczfistvvsrjeqkvkneqdshyaroskvkqxjvgbqdyjuhpmtkzjqrmkzmmqafdxptvaqdchicqemhqfrpokjcuirharodrdymdprhwzmofyvvfonwywyvgregjsmaxkoabhkziynnwkkdzzzzxaudramcsyepkusmdenlcbaalldmmfokhinalbddzjvmgpajtnxvqxxckaqxhejopwrayufzfcnlrnvkbuhtrexehodqumhjkylkurmztznnnkxqehjxnjbwxgnruwdfuorohdpdfeqsopkswvqmetidcxxwtadpqvdyavbfzrxqgjifharnwbryzouuqykgvpevkfbmyachkmmtnfglgzjhnfcddmkydquoyvcwvgfhstchyjshibqyhsdmgpnkgjaggecdkklcdnkeyeljidhpwkdecqqizqohuslgeyjilvmmzzvhceyaqehswxayoqfklqrpoczczloamlirpitfoaylyajotoaeftvtvvxuilvxyfonphvekvpivawqoywvsspnpokzahwaomofwljggaqdaourmqmekbuzqgzsnxsdkiiitsobugfvuzmgrylcchduneoccifotnwohmqcsvzmwnupnhrpovldzbfdkkrfapthdjlxgkjexgulnncekqhktnpfzhkbyejcpubyhlcgtyrgmwkwouihjynihxmfdvjtrlrayvhruazgwmekgnspnhzuelbiindcywcyrjrlkqtieavkppbcwdwcozmzmpdmlfkfrbsduolaogndxoftrdwickjramdntoukrnpnbdqpjdujtbcneaxilgbnufcnvxaompensueexanqbrfhscrfitseywstvuhhllwehakeazxdqckkhcprvjwtiqodkxlvjhbqklxmkwqdaanhcfzxqvsyngexepupywhijgvwclzfnomsvnrmkkmxsquyhrpgnxqwfnskatpokdgfrxtbjgbeyxcgosobrgawuuiwoxmadsfuszxdhahfymnmedqxkqvgmeccdpcgjicdjcjqcqvcelpkohhazfiljlqocsxncbtlfcbiuzmzmbjakrdjwlxhynxafuqiyjtdlxlfyaekdqmohpxfbuobhlepiuxgdsjqrxxpxezaumqbdoiekyiujmjtgiblcldukaljeljyzcbcqjjchrwtffolpqysdbonbzyimjgnlisbtbeducyzkmmzekthnhwojuyxeflppdtkgzpabnblcnnizgqmqoczlbyrijgzobjuazweoxpsmeblltzbhccufalpmuoavzvyatcptthfyitlbsolwqfdsrsengfigcggxkxqghwerrrvlfgivnnpggutobeufmdcxctdjrjbkawvheferttabptpsxmxmpcjtxodqzeabcvigbmxwfzxxtmpsyneprpjofoegsehubrcedbalbxiwmxommvefmnvubzavfkrjbtnhuosxnctzbkmqhqvvfrpissfaeyjhtyopoinckgdmqrezjzvosmynefpkdaswygmnpbrbhupamtbvvwmpjmcpstavtsuuyihpjyrsugugawexuqmdcpvukvsenoynyhdhhubbcykcuozqgouifpfpmztzptonarwjnznqxxutnwktkgdrxkgjlckavapysnhhnuzktwgiuqbgyhxxtdiffshduxbomkwzhxmcvslpkmvkvuhpapuhjdkdcnspyqohncjjuuagjyqesxtuopcxvmbxcvmaldhyfqjcnkiwkzaewwzlnbkipngriuttxcufvdhippeboggncfasimaxairidmecryhmdqwvgcwwiclnjnfrahpaqiktwovnmfbqvxldbjakmlzxzgpbngbdolwkauambbeyzrcabcmppnmqtdrhjukzgjmifmwgnbeougrxkfoctdsmgmvqgipordwwptefwkvqtooduchpfcdoozewhvlybhwsccxymvrfjfldjssruyfixlfeisejzcccebcswtyiajlmdgdyekidxpjhhprjrvnxyppvlpflasxeaceeomjlesvnhowajlzjbpgmglzhexnebrlqfudlpyzwmxzxjyhkpnywzzfdwshaluqspteesfcecdelclxryxpzxucvomvbilwxhcdzhiflnjxpwwjvuautxzonnmpvxlvepafwknjywintfyqbzmuynklcyaawnvccxkaixkgvsvqzwicxxyvkjgphjpfymkbjwdrtpzqkvjlrroqomlbxrqhafobraecwhwrzvilsrwlkkbzzmcyesfgzwjswnutvqkwmuhgndsyqtzrgbpmvxuuteoprikobvknrtvfznfphginjxbeuvanboftypjzmwoepkloxsfeypthnwnjsnzvdeqbtadiwtondbedtljrbdaoznztcypfcfiyhngfhutkvznqkzhlcjbdwbzybqfexpcfdkmkgfwdemtrlceplgujjtjkloqjfuqiecsmkrpqdkhoomdbuxkftvrejippchzjmuvwlnooxwcokhpggalzveghmvyrfzcrtxnembumzyalfprmrelpjryxpyouxqltqaxeduqfssqykkkdoxuxruvislcsepnwrkawetbznuxxejdsixszunhoalgectavgdsmyvllpklttoocngdhvnwvaecdaeagjsuhqitfsgboursjxvruiprlttotaobjjytzgogauhoqyizxesrohlzbgpwggyspwlqebwevgvngdmgjfzymkzprpmzvmrmiecohaseiprptgxenwcbhcratfzortczzenhghlpzfguldyyzbzifskyxmoqfqpgwencobrngzhtchreismpnxpmjddqvuwrbmwrppgxpnqrujvfdkwqhmfsrikneigfwcwlscijraaojyvnirfrfklzsvmxdueczdntfyczyenkckxkdcbjnmihjwgpslrrogmvgouftjpvvoizqlifyspjovyiipayymwedslwectzqdyjpiqpafyqdxznobompmrseeqkhmkzpkievbtvisolrpbfsrshdlajrsuyegawskcnlwluqbhjqkoibipgvrsnmonqwnmoypclnphfqrogbeqfnhnkzfzltndpcsgcjkoyzxfpotvqznxoukzvqyilnodqgjsrtiruiwjwrgoqtlfpwgloetbsjgkpreimnzgvxptovihqtogruthaojuypenhjytyzcvxrqnpyuhsinlegtfvczttgicriyriamfrcuidpqxzfieobljfmebsodlxbchdqovtifyxvvzdddrhocoagpvwvgvwjcazsxubeuacpzfveweuysvgkscfaabjedlxchahealtcqqgmubmnysxswesyhedlpapyayccjygzonnjqzyqtxisbaqietvvvlwxlaavagwpvkanladhznzaqrkwnguitqgesibtoykmimzvofcnudpkvzhihdsctyhngkixiulsikowrslowaytahbjktmfuvvcfdzqykiixyfqtqeprfktmlezgqgclbftfgjfrtpquugnnnegsobgbffjwomjptcwzndqjtidnpsccwiwkjcnpkwnykyndbkdqpvbieeyvyazulvgwxtnhsafczvgchluwgwfmcfhbfgxsdepbzcktdsweneiurcqzaxmdcvgkedchjrkjuxezpcfcgpyzrqzuonxsifcoifysyidufjvumcyurwulntfdievsjyhrfflfpqavaxrmasgroccdxhgfncywcfqjmdobuqywoqkqkshavmesvmyjoyhsfxbrbssxirvyjfovzyvukzphmpqcnyxsxyjasdxdwubhzsczqyvcxkjlzcooclgblrcgvbjrwmzxebywzuazgmkiqawundvzwxhrzqlxemujpvhrpiqxwcfmdcgqhbrdbaxcqizvwvglqpchzshvxmjaqpsxtmdwmayfkzcguitnxwwzqdunqepivkiqwlmknkpzlthibavbwtanxwcpcsxycfoasdkfncgbvnjzogcmzcbyaendyndauranumukobnmqwlecntdrucrarwygzabtcqppmbfporgkemotfumcygepcfycfbxitmxfoevcwbpcpfyvbkzzqdrvipzqqwyjixqybldzoucebabdmccdhtyskzicvgnfdeeerjeidimekpjwrmzyhzqsyauvgiblmhsfqynvibbsqlojzqkgrcyqdtlldozrvtwnrkkznmtgzhpyzbergfjjauwdlxuiqqyhciiqwdwvnnvmrcdxhmihjekwcgeswccblmthsrffearxcxuljcsuheqlkvfjzjkkyfuqwbvcdmagjutvxmrgsitdfymeiyrgdnybotdrhfztcvozhhhzpcewasdkqusvjqyzlcstjumlpamwhtxzxcvywyknufkfxjejnxcwroigquezqbanfwncwartfdycmdlbcpytdizvefvwivmotbssblniolldqyesqentoopttmrchdsdfmvixirnvesoexiudwqsmhngtekckcfroabnksciyvwfsezxcrrpyevrlhuxjbozcpookqwklspfzpdbgwqhdnyouundwdeassoelnpwfecgvhiedylimlygglmcosejnsnyfeunlytihdmnezvqluythmvwfzfstuqbbmqmllwupjhtkflvbjoiwledmlviiljjzzxmmthbeqwpxhmytbhrolubzplhcuqbvpqhixlpphenpqlktsbkgvlfmwoosgrpvhyfgjuwrajitwsoptyxqlccjssbyjsttrazavxtxibqfvfwqdtipxkypccnouijlikofihdslvxiavzgqhxnuxeyztmwdvjmgxtqfwissiaudbaujxjfxodyjsunnebvdulirwaledfheibphnuebadmszzhdcdjxqtqmwbsziadqdtaqpetpjghjhrokuxjmrzbnctmmvrfzmfrclntvtdgcuuoquxclydacxopufwtubnyoarlvurxqomgiljvmovonlfiqddmgqkvqcglyalpozvymgtyvopizwqrauggmqddumqtmdkcchapotpljetkdmddijlucpzwbsrpvdtaltpbogmznhlqvqvdagaexbcaturrzkrmfintobublhtgyomyxoewpgxlcoccbvogdecrhwvseobcfnccbiysoxdrohvpclxhrzbzywtcmugrjktmsufitibhsyyukwcdvdctbyxnufferaqlwxuqixxawywiualrdqngokuksboldhxagtqoqpqonnwjnkdtaqzqcvauyrgcafcgyuvqlnfbadkqpnjrfkhiikegdkidrmjpggisunvwsfmivxzakjksvpaybjbtvkketsyphtlaaakxzlalukfrzgpdpqwmdgswzsnilaioculcgnpcyvuzbjcsaagfhzditqqhqbvvvixdwogwjavmlaenalsjmvtfnmmgnjbksaoqowmayjmjjrxmervsnrxcdmksvlepnsfeqteofqyojvcpmyhbrhgutqmqeqgrlnvbjzqosqednhvzhcdyjluebgvfydzlsupbwhpqxwvkdqlmvqmgbglfoimonlafirhgyywvutfzkqnfhznkfypvickvpmbxdkdbibwfvdehvsoerbpzcewkigiyulxzvbadcyixbpgxhudawsbyzykjgshddfcaifemdomhfsgonjrjeshdsrmbmwgpdiqnnwztmlcseiirtzaxsjcmcrponvgsgyftueoisqcwalpukpteawtcnitcgzumxbhthwdzogvptkldbekdadgnnzrtalhzmpsunvvbdtswfdchimmkrsagtrcvdjuryonnmjppchohnqqvedhvxhdtzfoepjvpxldjusbybphohylldtiaaltbrifitdxqoackudiwupmbpamsvwtxhozaygirjgkxgojdrrbnjnoypctkymifcjibpqsbweyfskklblymaonqqgcoumwwvexnwsovyoarykecxfoxtbnkhsadeyacczpztfusvwluipyfumeqquczmcdsbfufelgyqcsmydiiugpruuhmojoanrsoypwcacctfwhfbrqwzfptzyiphwrwnknlbjpdluwsqfaswqqvxfrxdzomvgiksxxtgowuivobcotbglyesrdxqrlnxtzprykznjtxeiyiytjfgijybmvsdghdcjsvjfwyoqysawcasmfawqzxcwrifbljmfgvkcuausswqxxkjenhvogzkahrbucpckkongpjajgtgffrjsyeghethnmikpzmzjaosryubgpjlvbupbbwihrpudzeuyswkvmemmypuozflccaffyomrfgvhnrhfptacxnqyelmdszhuznbadnrkuorjiboxupbuessifgoxfvsgktgnjyyfmrouucuprvlxpdgujusqpmwahdpqdpxrhlmdoiuhfffvknrvhllyxiahnqzqfxhokvuydoijupgeezallnlkvmtictyjsiacdudhknsecalgzntkaexyqqiujhgdpiguejbowvvaviivvdhxhgvaxgwinememsysdchzxebvmjsjmzgvgevfkunzyzfntffwjovjsweehwptvwrdcmioiynhxuwrbbplslukjyrtugorefxgshwcfljfffwhjlubyonkoedknrdrxaarkwtpkfupmsyvguygimsyqxifpmzoozhyxcqhjmzwhztnuuvegqdynneezduqebobgglrtmpanlphfmolcrjqenugspwwsmaatnsmzjooudwzpkksdwkjlerevncqceqxrkjsuzhqcfqtrcnuyxfmexsbmurobilsuwnoxufzbxvszkoaitooqgpfchtdrhylflcdhjekgbchmqjwjxkcdzhiicnzlllrypwhyareevlqlvmxuwzaxiigkvhwjupjjlthnknribjtwvssttstbaboyimjdbsoolwdyjvgmgbicudxpvqrwrhwatffwztklrnldkrptuavqdugylzwcgsebzlxzhjmyyxblqtektbbyvhyiivnoprrpfqomzckzzokrhobcrecnnaxvvklneccjssvtuhtvvfmewpinumcjnafkksxoxzzrtunnegkblwihmsxifzrsbycmtacqbcjvywkeevgqtozhgwplyjfzjinckqulugiuctzhqhzjvardzirxtwyfgmhqeeeakmuohvxzcyjzzcdamuzgsxlzjuppatpmimdrharmbcnaeqcsmbyfylekivzkrpxzdcsmcjydlmfrejktkkyjyevizusqlrrotkdyvbdjplawukrfxrqvvldwhxptpgjksmioqoxhzzftmwajnsgkdjhniwixetixisnygmhhnpbzndibwonbzuoisyhxsrwamlaszjamydomiypencioxyyrxiopzmrlxrgyaglblzntxeamgkdfidxhlnylcpyziealmnmzmbvlfxalhftriszwfzhhrhjzmjkywwykzvxeszszglspftlmtuukbflpqwoouoaujzadzucfhuwmojzjfvvjagyseoizeivnjxqksuszromhalqfgloirpcwdkxiuuxdrqojkglbwxiykagslucfjedpqaxmuurnkfzxnkymjjmvlsnzpreaxhpnjmzfhqstytqndrbocojngymvpqwmznbiacnjvicvbvihmmxoahbihqgzgenirpqttgcoohjpcuyqgweifhqmxwngabouqgnjmsaczjsddsvlobttkkiiivqlwgfoouabmadnlxsrqnegoyczkkjuhbfgjmwxhwyvyejmbdftrjchheitqtoxwvfficdradmbjx".to_owned(); + assert_eq!(Solution::min_window(s, t), expected); + } +} diff --git a/src/problem/p0077_combinations.rs b/src/problem/p0077_combinations.rs new file mode 100644 index 00000000..bfeeab1d --- /dev/null +++ b/src/problem/p0077_combinations.rs @@ -0,0 +1,116 @@ +/** + * [77] Combinations + * + * Given two integers n and k, return all possible combinations of k numbers out of 1 ... n. + * You may return the answer in any order. + * + * Example 1: + * + * Input: n = 4, k = 2 + * Output: + * [ + * [2,4], + * [3,4], + * [2,3], + * [1,2], + * [1,3], + * [1,4], + * ] + * + * Example 2: + * + * Input: n = 1, k = 1 + * Output: [[1]] + * + * + * Constraints: + * + * 1 <= n <= 20 + * 1 <= k <= n + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/combinations/ +// discuss: https://leetcode.com/problems/combinations/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn helper(result: &mut Vec>, tmp: &mut Vec, start:i32, n: i32, k: usize) { + // println!("start={}, n={}, k={}, tmp={:?}", start, n, k, tmp); + if k == 0 { + result.push(tmp.clone()); + return; + } + for i in start..=n { + tmp.push(i); + Self::helper(result, tmp, i + 1, n, k-1); + tmp.pop(); + } + // println!("==============================================="); + } + + pub fn combine(n: i32, k: i32) -> Vec> { + let mut result = vec![]; + let mut tmp = vec![]; + Self::helper(&mut result, &mut tmp, 1, n, k as usize); + result + } + + + pub fn combine_dp(n: i32, k: i32) -> Vec> { + let n = n as usize; + let k = k as usize; + let mut all : Vec>> = vec![vec![vec![]]; k+1]; + + for ni in 1..=n { + // (1..i as i32).collect(); + all[0] = vec![vec![]]; + for ki in (1..=k as usize).rev() { + if ki == ni { + all[ni] = vec![(1..=ni as i32).collect()]; + + } else if ki < ni { + // println!("\tki={}, ni={}, all[ki-1] = {:?}", ki, ni, all[ki-1]); + for mut prev_comb in all[ki-1].clone() { + prev_comb.push(ni as i32); + // println!("\tki={}, ni={}, prev_comb = {:?}", ki, ni, prev_comb); + all[ki].push(prev_comb); + } + + } else { + // n < ki => invalid case, ignore. + } + } + // println!("ni={}, {:?}", ni, all); + } + all[k].clone() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_77() { + assert_eq!( + Solution::combine(4, 2), + vec![ + vec![1, 2], + vec![1, 3], + vec![1, 4], + vec![2, 3], + vec![2, 4], + vec![3, 4] + ] + ); + assert_eq!(Solution::combine(1, 1), vec![vec![1]]); + let empty: Vec> = vec![]; + assert_eq!(Solution::combine(0, 1), empty); + assert_eq!(Solution::combine(2, 1), vec![vec![1], vec![2]]); + } +} diff --git a/src/problem/p0078_subsets.rs b/src/problem/p0078_subsets.rs new file mode 100644 index 00000000..534e7de6 --- /dev/null +++ b/src/problem/p0078_subsets.rs @@ -0,0 +1,85 @@ +/** + * [78] Subsets + * + * Given an integer array nums of unique elements, return all possible subsets (the power set). + * The solution set must not contain duplicate subsets. Return the solution in any order. + * + * Example 1: + * + * Input: nums = [1,2,3] + * Output: [[],[1],[2],[1,2],[3],[1,3],[2,3],[1,2,3]] + * + * Example 2: + * + * Input: nums = [0] + * Output: [[],[0]] + * + * + * Constraints: + * + * 1 <= nums.length <= 10 + * -10 <= nums[i] <= 10 + * All the numbers of nums are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/subsets/ +// discuss: https://leetcode.com/problems/subsets/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + + +impl Solution { + pub fn backtrack_helper

(result : &mut Vec>, tmp : &mut Vec, elements : &Vec, predicate: P, start : usize, no_dup : bool, element_reusable : bool) where P:Fn(&Vec)->(bool, bool) + Copy { + // is_sorted() is only supported in nightly-built rust + // if no_dup && !elements.is_sorted() { + // panic!("Elements must be presorted to deduplicate."); + // } + let n : usize = elements.len(); + let (valid , backtrack) = predicate(tmp); + if valid { + result.push(tmp.clone()); + } + if backtrack { + for i in start..n { + let backtrack : bool = if !no_dup {true} else if i==start{true}else if elements[i-1] != elements[i] {true}else{false}; + + if backtrack { + tmp.push(elements[i]); + let next_start = if element_reusable { i } else { i+1 }; + Self::backtrack_helper(result, tmp, elements, predicate, next_start, no_dup, element_reusable); + tmp.pop(); + } + } + } + } + + pub fn subsets(mut nums: Vec) -> Vec> { + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let element_reusable = false; + let no_dup = false; + + let predicate = |tmp : &Vec|{ (true, true) }; + Self::backtrack_helper(&mut result, &mut tmp, &nums, predicate, 0, no_dup, element_reusable); + result + } + +} +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_78() { + // assert_eq!(Solution::subsets(vec![]), vec![vec![]]); + // assert_eq!(Solution::subsets(vec![1]), vec![vec![], vec![1]]); + assert_eq!( + Solution::subsets(vec![1, 2]), + vec![vec![], vec![1], vec![1,2], vec![2]] + ); + } +} diff --git a/src/problem/p0079_word_search.rs b/src/problem/p0079_word_search.rs new file mode 100644 index 00000000..3adcffee --- /dev/null +++ b/src/problem/p0079_word_search.rs @@ -0,0 +1,119 @@ +use serde::de::Visitor; + +/** + * [79] Word Search + * + * Given an m x n grid of characters board and a string word, return true if word exists in the grid. + * The word can be constructed from letters of sequentially adjacent cells, where adjacent cells are horizontally or vertically neighboring. The same letter cell may not be used more than once. + * + * Example 1: + * + * Input: board = [["A","B","C","E"],["S","F","C","S"],["A","D","E","E"]], word = "ABCCED" + * Output: true + * + * Example 2: + * + * Input: board = [["A","B","C","E"],["S","F","C","S"],["A","D","E","E"]], word = "SEE" + * Output: true + * + * Example 3: + * + * Input: board = [["A","B","C","E"],["S","F","C","S"],["A","D","E","E"]], word = "ABCB" + * Output: false + * + * + * Constraints: + * + * m == board.length + * n = board[i].length + * 1 <= m, n <= 6 + * 1 <= word.length <= 15 + * board and word consists of only lowercase and uppercase English letters. + * + * + * Follow up: Could you use search pruning to make your solution faster with a larger board? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/word-search/ +// discuss: https://leetcode.com/problems/word-search/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashSet; +impl Solution { + pub fn track(board: &Vec>, i : i32, j : i32, target : &String, visited: &mut HashSet<(i32,i32)>) -> bool{ + if target.len() == 0 {return true;} + let target_char : char = target.chars().nth(0).unwrap(); + let row_count : i32 = board.len() as i32; + let col_count : i32 = board[0].len() as i32; + let mut found = false; + if (!visited.contains(&(i,j)) && 0 <= i && i < row_count && 0 <= j && j < col_count && board[i as usize][j as usize] == target_char) { + let next_target : String = String::from(&target[1..]); + visited.insert((i,j)); + found = Self::track(board, i-1, j, &next_target, visited) || + Self::track(board, i+1, j, &next_target, visited) || + Self::track(board, i, j-1, &next_target, visited) || + Self::track(board, i, j+1, &next_target, visited); + visited.remove(&(i,j)); + } + + found + } + + pub fn exist(board: Vec>, word: String) -> bool { + for i in 0..board.len() { + for j in 0..board[0].len() { + let mut visited = HashSet::new(); + if Self::track(&board, i as i32, j as i32, &word, &mut visited) {return true;} + } + } + + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_79() { + assert_eq!(Solution::exist(vec![vec!['a']], "a".to_owned()), true); + assert_eq!( + Solution::exist( + vec![ + vec!['A', 'B', 'C', 'E'], + vec!['S', 'F', 'C', 'S'], + vec!['A', 'D', 'E', 'E'], + ], + "ABCCED".to_owned() + ), + true + ); + assert_eq!( + Solution::exist( + vec![ + vec!['A', 'B', 'C', 'E'], + vec!['S', 'F', 'C', 'S'], + vec!['A', 'D', 'E', 'E'], + ], + "SEE".to_owned() + ), + true + ); + assert_eq!( + Solution::exist( + vec![ + vec!['A', 'B', 'C', 'E'], + vec!['S', 'F', 'C', 'S'], + vec!['A', 'D', 'E', 'E'], + ], + "ABCB".to_owned() + ), + false + ); + } +} diff --git a/src/problem/p0080_remove_duplicates_from_sorted_array_ii.rs b/src/problem/p0080_remove_duplicates_from_sorted_array_ii.rs new file mode 100644 index 00000000..2c705558 --- /dev/null +++ b/src/problem/p0080_remove_duplicates_from_sorted_array_ii.rs @@ -0,0 +1,91 @@ +/** + * [80] Remove Duplicates from Sorted Array II + * + * Given a sorted array nums, remove the duplicates in-place such that duplicates appeared at most twice and return the new length. + * Do not allocate extra space for another array; you must do this by modifying the input array in-place with O(1) extra memory. + * Clarification: + * Confused why the returned value is an integer, but your answer is an array? + * Note that the input array is passed in by reference, which means a modification to the input array will be known to the caller. + * Internally you can think of this: + * + * // nums is passed in by reference. (i.e., without making a copy) + * int len = removeDuplicates(nums); + * // any modification to nums in your function would be known by the caller. + * // using the length returned by your function, it prints the first len elements. + * for (int i = 0; i < len; i++) { + * print(nums[i]); + * } + * + * + * Example 1: + * + * Input: nums = [1,1,1,2,2,3] + * Output: 5, nums = [1,1,2,2,3] + * Explanation: Your function should return length = 5, with the first five elements of nums being 1, 1, 2, 2 and 3 respectively. It doesn't matter what you leave beyond the returned length. + * + * Example 2: + * + * Input: nums = [0,0,1,1,1,1,2,3,3] + * Output: 7, nums = [0,0,1,1,2,3,3] + * Explanation: Your function should return length = 7, with the first seven elements of nums being modified to 0, 0, 1, 1, 2, 3 and 3 respectively. It doesn't matter what values are set beyond the returned length. + * + * + * Constraints: + * + * 1 <= nums.length <= 3 * 10^4 + * -10^4 <= nums[i] <= 10^4 + * nums is sorted in ascending order. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/remove-duplicates-from-sorted-array-ii/ +// discuss: https://leetcode.com/problems/remove-duplicates-from-sorted-array-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn remove_duplicates(nums: &mut Vec) -> i32 { + let l : usize = nums.len(); + let mut i : usize = 0; + let mut pre_inserted_num : i32 = -100000; // any num not in nums + let mut pre_inserted_count : usize = 2; + let mut insert_pos : usize = 0; + while i < l { + if nums[i] == pre_inserted_num { + if pre_inserted_count == 1 { + nums[insert_pos] = nums[i]; + insert_pos +=1; + pre_inserted_count = 2; + } else { + // do nothing as the pre_inserted_num is included twice + } + } else { + nums[insert_pos] = nums[i]; + insert_pos +=1; + pre_inserted_num = nums[i]; + pre_inserted_count = 1; + } + i+=1; + } + insert_pos as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_80() { + let mut nums : Vec = vec![1,1,1,2,2,3]; + assert_eq!(Solution::remove_duplicates(&mut nums), 5); + assert_eq!(nums[..5], vec![1,1,2,2,3]); + + let mut nums : Vec = vec![0,0,1,1,1,1,2,3,3]; + assert_eq!(Solution::remove_duplicates(&mut nums), 7); + assert_eq!(nums[..7], vec![0,0,1,1,2,3,3]); + } +} diff --git a/src/problem/p0081_search_in_rotated_sorted_array_ii.rs b/src/problem/p0081_search_in_rotated_sorted_array_ii.rs new file mode 100644 index 00000000..ef4b4aae --- /dev/null +++ b/src/problem/p0081_search_in_rotated_sorted_array_ii.rs @@ -0,0 +1,93 @@ +/** + * [81] Search in Rotated Sorted Array II + * + * There is an integer array nums sorted in non-decreasing order (not necessarily with distinct values). + * Before being passed to your function, nums is rotated at an unknown pivot index k (0 <= k < nums.length) such that the resulting array is [nums[k], nums[k+1], ..., nums[n-1], nums[0], nums[1], ..., nums[k-1]] (0-indexed). For example, [0,1,2,4,4,4,5,6,6,7] might be rotated at pivot index 5 and become [4,5,6,6,7,0,1,2,4,4]. + * Given the array nums after the rotation and an integer target, return true if target is in nums, or false if it is not in nums. + * + * Example 1: + * Input: nums = [2,5,6,0,0,1,2], target = 0 + * Output: true + * Example 2: + * Input: nums = [2,5,6,0,0,1,2], target = 3 + * Output: false + * + * Constraints: + * + * 1 <= nums.length <= 5000 + * -10^4 <= nums[i] <= 10^4 + * nums is guaranteed to be rotated at some pivot. + * -10^4 <= target <= 10^4 + * + * + * Follow up: This problem is the same as Search in Rotated Sorted Array, where nums may contain duplicates. Would this affect the runtime complexity? How and why? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/search-in-rotated-sorted-array-ii/ +// discuss: https://leetcode.com/problems/search-in-rotated-sorted-array-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + + pub fn search(nums: Vec, target: i32) -> bool { + let mut low : i32 = 0; + let mut high : i32 = nums.len() as i32 - 1; + while low <= high { + let mid : i32 = (low + high) / 2; + let mid_num : i32 = nums[mid as usize]; + let right_num : i32 = nums[high as usize]; + let left_num : i32 = nums[low as usize]; + // println!("low[{}]={}, mid[{}]={}, right[{}]={}", low, left_num, mid, mid_num, high, right_num); + if mid_num == target { + return true; + } else if left_num < mid_num { + //[low, mid] must be sorted. + if left_num <= target && target < mid_num { + // in the ordered left half + high = mid - 1; + } else { + low = mid + 1; + } + } else if left_num > mid_num { + // [mid, high] must be sorted. + if mid_num < target && target <= right_num { + // in the ordered right half + low = mid + 1; + } else { + high = mid - 1; + } + } else { + low += 1; + } + } + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_81() { + assert_eq!( + Solution::search(vec![1,1,1,1,1,1,1,1,1,1,1,1,1,2,1,1,1,1,1], 2), + true + ); + + assert_eq!( + Solution::search(vec![1,1], 0), + false + ); + + assert_eq!( + Solution::search(vec![1,0,1,1,1], 0), + true + ); + + } +} diff --git a/src/problem/p0082_remove_duplicates_from_sorted_list_ii.rs b/src/problem/p0082_remove_duplicates_from_sorted_list_ii.rs new file mode 100644 index 00000000..20b34d97 --- /dev/null +++ b/src/problem/p0082_remove_duplicates_from_sorted_list_ii.rs @@ -0,0 +1,92 @@ +/** + * [82] Remove Duplicates from Sorted List II + * + * Given the head of a sorted linked list, delete all nodes that have duplicate numbers, leaving only distinct numbers from the original list. Return the linked list sorted as well. + * + * Example 1: + * + * Input: head = [1,2,3,3,4,4,5] + * Output: [1,2,5] + * + * Example 2: + * + * Input: head = [1,1,1,2,3] + * Output: [2,3] + * + * + * Constraints: + * + * The number of nodes in the list is in the range [0, 300]. + * -100 <= Node.val <= 100 + * The list is guaranteed to be sorted in ascending order. + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/remove-duplicates-from-sorted-list-ii/ +// discuss: https://leetcode.com/problems/remove-duplicates-from-sorted-list-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn delete_duplicates(head: Option>) -> Option> { + if head.is_none() {return None;} + + let mut fake_list : Option> = Some(Box::new(ListNode::new(0))); + let mut fake_tail : &mut Box = fake_list.as_mut().unwrap(); + + let mut prev_val : i32 = head.as_ref().unwrap().val; + let mut has_dup = false; + + let mut cur_node : &Option> = &(head.as_ref().unwrap().next); + while cur_node.is_some() { + let cur_val = cur_node.as_ref().unwrap().val; + if cur_val == prev_val { + has_dup = true; + } else if has_dup { + prev_val = cur_val; + has_dup = false; + } else { + fake_tail.next = Some(Box::new(ListNode::new(prev_val))); + fake_tail = fake_tail.next.as_mut().unwrap(); + + prev_val = cur_val; + has_dup = false; + } + cur_node = &(cur_node.as_ref().unwrap().next); + } + if !has_dup { + fake_tail.next = Some(Box::new(ListNode::new(prev_val))); + } + fake_list.unwrap().next + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_82() { + assert_eq!(Solution::delete_duplicates(to_list(vec![1,2,3,3,4,4,5])), to_list(vec![1,2,5])); + } +} diff --git a/src/problem/p0083_remove_duplicates_from_sorted_list.rs b/src/problem/p0083_remove_duplicates_from_sorted_list.rs new file mode 100644 index 00000000..887beba0 --- /dev/null +++ b/src/problem/p0083_remove_duplicates_from_sorted_list.rs @@ -0,0 +1,89 @@ +/** + * [83] Remove Duplicates from Sorted List + * + * Given the head of a sorted linked list, delete all duplicates such that each element appears only once. Return the linked list sorted as well. + * + * Example 1: + * + * Input: head = [1,1,2] + * Output: [1,2] + * + * Example 2: + * + * Input: head = [1,1,2,3,3] + * Output: [1,2,3] + * + * + * Constraints: + * + * The number of nodes in the list is in the range [0, 300]. + * -100 <= Node.val <= 100 + * The list is guaranteed to be sorted in ascending order. + * + */ +pub struct Solution {} +use std::any::type_name; + + +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/remove-duplicates-from-sorted-list/ +// discuss: https://leetcode.com/problems/remove-duplicates-from-sorted-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } + +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } + +fn type_of(_: T) -> &'static str { + type_name::() +} + + +impl Solution { + + + + + pub fn delete_duplicates(head: Option>) -> Option> { + let mut head = head; + let mut cur = head.as_mut(); + while cur.is_some() && cur.as_ref().unwrap().next.is_some() { + if cur.as_ref().unwrap().val == cur.as_ref().unwrap().next.as_ref().unwrap().val + { + let next = cur.as_mut().unwrap().next.as_mut().unwrap().next.take(); + cur.as_mut().unwrap().next = next; + } else { + cur = cur.unwrap().next.as_mut(); + } + } + head + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_83() { + // let s : Option = 2; + let _ = super::Solution::delete_duplicates(Some(Box::new(ListNode::new(0)))); + } +} diff --git a/src/problem/p0084_largest_rectangle_in_histogram.rs b/src/problem/p0084_largest_rectangle_in_histogram.rs new file mode 100644 index 00000000..3a2739f7 --- /dev/null +++ b/src/problem/p0084_largest_rectangle_in_histogram.rs @@ -0,0 +1,106 @@ +/** + * [84] Largest Rectangle in Histogram + * + * Given an array of integers heights representing the histogram's bar height where the width of each bar is 1, return the area of the largest rectangle in the histogram. + * + * Example 1: + * + * Input: heights = [2,1,5,6,2,3] + * Output: 10 + * Explanation: The above is a histogram where width of each bar is 1. + * The largest rectangle is shown in the red area, which has an area = 10 units. + * + * Example 2: + * + * Input: heights = [2,4] + * Output: 4 + * + * + * Constraints: + * + * 1 <= heights.length <= 10^5 + * 0 <= heights[i] <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/largest-rectangle-in-histogram/ +// discuss: https://leetcode.com/problems/largest-rectangle-in-histogram/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +// use std::collections::VecDeque; +impl Solution { + pub fn largest_rectangle_area(heights: Vec) -> i32 { + let n = heights.len(); + + let mut left_rightmost_smaller_idx = vec![-1i32;n]; + let mut stack : Vec = vec![]; + for (i, &height) in heights.iter().enumerate() { + while let Some(&last_idx) = stack.last() { + if !(heights[last_idx] < height) { + stack.pop(); + } else { + break; + } + } + + if let Some(&last_idx) = stack.last() { + left_rightmost_smaller_idx[i] = last_idx as i32; + } else { + left_rightmost_smaller_idx[i] = -1; + } + stack.push(i); + } + + let mut stack : Vec = vec![]; + let mut right_leftmost_smaller_idx = vec![n as i32;n]; + for (i, &height) in heights.iter().enumerate().rev() { + while let Some(&last_idx) = stack.last() { + if !(heights[last_idx] < height) { + stack.pop(); + } else { + break; + } + } + + if let Some(&last_idx) = stack.last() { + right_leftmost_smaller_idx[i] = last_idx as i32; + } else { + right_leftmost_smaller_idx[i] = n as i32; + } + stack.push(i); + } + + let mut max_area : i32 = 0; + // println!("heights={:?}", heights); + // println!("left_rightmost_smaller_idx={:?}", left_rightmost_smaller_idx); + // println!("right_leftmost_smaller_idx={:?}", right_leftmost_smaller_idx); + for i in 0..n { + max_area = std::cmp::max(max_area, heights[i] * (right_leftmost_smaller_idx[i] - left_rightmost_smaller_idx[i]-1)); + } + max_area + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_84() { + assert_eq!(Solution::largest_rectangle_area(vec![2, 1, 5, 6, 2, 3]), 10); + assert_eq!( + Solution::largest_rectangle_area(vec![1, 1, 1, 1, 1, 1, 1, 1]), + 8 + ); + assert_eq!(Solution::largest_rectangle_area(vec![2, 2]), 4); + assert_eq!( + Solution::largest_rectangle_area(vec![1, 2, 8, 8, 2, 2, 1]), + 16 + ); + assert_eq!(Solution::largest_rectangle_area(vec![2, 1, 2]), 3); + assert_eq!(Solution::largest_rectangle_area(vec![1, 3, 2, 1, 2]), 5); + } +} diff --git a/src/problem/p0085_maximal_rectangle.rs b/src/problem/p0085_maximal_rectangle.rs new file mode 100644 index 00000000..fb4c2af2 --- /dev/null +++ b/src/problem/p0085_maximal_rectangle.rs @@ -0,0 +1,125 @@ +/** + * [85] Maximal Rectangle + * + * Given a rows x cols binary matrix filled with 0's and 1's, find the largest rectangle containing only 1's and return its area. + * + * Example 1: + * + * Input: matrix = [["1","0","1","0","0"],["1","0","1","1","1"],["1","1","1","1","1"],["1","0","0","1","0"]] + * Output: 6 + * Explanation: The maximal rectangle is shown in the above picture. + * + * Example 2: + * + * Input: matrix = [] + * Output: 0 + * + * Example 3: + * + * Input: matrix = [["0"]] + * Output: 0 + * + * Example 4: + * + * Input: matrix = [["1"]] + * Output: 1 + * + * Example 5: + * + * Input: matrix = [["0","0"]] + * Output: 0 + * + * + * Constraints: + * + * rows == matrix.length + * cols == matrix[i].length + * 0 <= row, cols <= 200 + * matrix[i][j] is '0' or '1'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/maximal-rectangle/ +// discuss: https://leetcode.com/problems/maximal-rectangle/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn maximal_rectangle(matrix: Vec>) -> i32 { + let row_count : usize = matrix.len(); + if row_count == 0 {return 0;} + let col_count : usize = matrix[0].len(); + let mut heights : Vec> = vec![vec![0;col_count];row_count]; + let mut cur_max : i32 = 0; + + for i in 0..row_count { + for j in 0..col_count { + if matrix[i][j] != '1' {continue;} + heights[i][j] = 1; + if i >= 1 {heights[i][j] += heights[i-1][j] } + } + + let mut left_stack : Vec = vec![]; + let mut leftmost_shorter : Vec = vec![]; + for j in 0..col_count { + while left_stack.len() != 0 { + let prev_col : usize = *left_stack.last().unwrap(); + if heights[i][prev_col] < heights[i][j] { + break + } else { + left_stack.pop(); + } + } + if left_stack.len() == 0 { + leftmost_shorter.push(-1); + } else { + leftmost_shorter.push(*left_stack.last().unwrap() as i32); + } + left_stack.push(j); + } + + let mut right_stack : Vec = vec![]; + let mut rightmost_shorter : Vec = vec![]; + for j in (0..col_count).rev() { + while right_stack.len() != 0 { + let prev_col : usize = *right_stack.last().unwrap(); + if heights[i][prev_col] < heights[i][j] { + break + } else { + right_stack.pop(); + } + } + if right_stack.len() == 0 { + rightmost_shorter.push(col_count as i32); + } else { + rightmost_shorter.push(*right_stack.last().unwrap() as i32); + } + right_stack.push(j); + } + rightmost_shorter = rightmost_shorter.into_iter().rev().collect(); + + // println!("i={}", i); + // println!("heights={:?}", heights[i]); + // println!("leftmost_shorter={:?}", leftmost_shorter); + // println!("rightmost_shorter={:?}", rightmost_shorter); + for j in 0..col_count { + cur_max = std::cmp::max(cur_max, (rightmost_shorter[j] - leftmost_shorter[j] - 1) * heights[i][j] as i32); + } + } + cur_max + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_85() { + assert_eq!(Solution::maximal_rectangle( + vec![vec!['1','0','1','0','0'],vec!['1','0','1','1','1'],vec!['1','1','1','1','1'],vec!['1','0','0','1','0']]), 6); + } +} diff --git a/src/problem/p0086_partition_list.rs b/src/problem/p0086_partition_list.rs new file mode 100644 index 00000000..11e82695 --- /dev/null +++ b/src/problem/p0086_partition_list.rs @@ -0,0 +1,90 @@ +/** + * [86] Partition List + * + * Given the head of a linked list and a value x, partition it such that all nodes less than x come before nodes greater than or equal to x. + * You should preserve the original relative order of the nodes in each of the two partitions. + * + * Example 1: + * + * Input: head = [1,4,3,2,5,2], x = 3 + * Output: [1,2,2,4,3,5] + * + * Example 2: + * + * Input: head = [2,1], x = 2 + * Output: [1,2] + * + * + * Constraints: + * + * The number of nodes in the list is in the range [0, 200]. + * -100 <= Node.val <= 100 + * -200 <= x <= 200 + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/partition-list/ +// discuss: https://leetcode.com/problems/partition-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn partition(head: Option>, x: i32) -> Option> { + let mut lt_list = Some(Box::new(ListNode::new(0))); + let mut lt_tail = lt_list.as_mut().unwrap(); + let mut ge_list = Some(Box::new(ListNode::new(0))); + let mut ge_tail = ge_list.as_mut().unwrap(); + + let mut cur = head.as_ref(); + while let Some(cur_node) = cur { + if cur_node.val < x { + lt_tail.next = Some(Box::new(ListNode::new(cur_node.val))); + lt_tail = lt_tail.next.as_mut().unwrap(); + } else { + ge_tail.next = Some(Box::new(ListNode::new(cur_node.val))); + ge_tail = ge_tail.next.as_mut().unwrap(); + } + cur = cur_node.next.as_ref(); + } + lt_tail.next = ge_list.unwrap().next; + lt_list.unwrap().next + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_86() { + assert_eq!( + Solution::partition(linked![1, 4, 3, 2, 5, 2], 3), + linked![1, 2, 2, 4, 3, 5] + ); + assert_eq!( + Solution::partition(linked![1, 4, 3, 2, 5, 2], 8), + linked![1, 4, 3, 2, 5, 2] + ); + assert_eq!(Solution::partition(linked![], 0), linked![]); + } +} diff --git a/src/problem/p0087_scramble_string.rs b/src/problem/p0087_scramble_string.rs new file mode 100644 index 00000000..9ecbbbc7 --- /dev/null +++ b/src/problem/p0087_scramble_string.rs @@ -0,0 +1,150 @@ +/** + * [87] Scramble String + * + * We can scramble a string s to get a string t using the following algorithm: + *

    + * If the length of the string is 1, stop. + * If the length of the string is > 1, do the following: + * + * Split the string into two non-empty substrings at a random index, i.e., if the string is s, divide it to x and y where s = x + y. + * Randomly decide to swap the two substrings or to keep them in the same order. i.e., after this step, s may become s = x + y or s = y + x. + * Apply step 1 recursively on each of the two substrings x and y. + * + * + *
+ * Given two strings s1 and s2 of the same length, return true if s2 is a scrambled string of s1, otherwise, return false. + * + * Example 1: + * + * Input: s1 = "great", s2 = "rgeat" + * Output: true + * Explanation: One possible scenario applied on s1 is: + * "great" --> "gr/eat" // divide at random index. + * "gr/eat" --> "gr/eat" // random decision is not to swap the two substrings and keep them in order. + * "gr/eat" --> "g/r / e/at" // apply the same algorithm recursively on both substrings. divide at ranom index each of them. + * "g/r / e/at" --> "r/g / e/at" // random decision was to swap the first substring and to keep the second substring in the same order. + * "r/g / e/at" --> "r/g / e/ a/t" // again apply the algorithm recursively, divide "at" to "a/t". + * "r/g / e/ a/t" --> "r/g / e/ a/t" // random decision is to keep both substrings in the same order. + * The algorithm stops now and the result string is "rgeat" which is s2. + * As there is one possible scenario that led s1 to be scrambled to s2, we return true. + * + * Example 2: + * + * Input: s1 = "abcde", s2 = "caebd" + * Output: false + * + * Example 3: + * + * Input: s1 = "a", s2 = "a" + * Output: true + * + * + * Constraints: + * + * s1.length == s2.length + * 1 <= s1.length <= 30 + * s1 and s2 consist of lower-case English letters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/scramble-string/ +// discuss: https://leetcode.com/problems/scramble-string/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::collections::HashMap; +impl Solution { + pub fn is_scramble_topdown(s1: &Vec, start1 : usize, end1 : usize, + s2: &Vec, start2 : usize, end2 : usize, cache : &mut HashMap<(usize,usize,usize), bool>, level : usize) -> bool { + assert_eq!(end1 - start1, end2 - start2); + let pad : String = (0..level).map(|x|{" "}).collect(); + let l : usize = end1 - start1; + if l == 1 { return s1[start1] == s2[start2]; } + if let Some(&cached) = cache.get(&(start1, start2, l)) { + return cached; + } + + println!("{}start1={}, end1={}, start2={}, end2={}", pad, start1, end1, start2, end2); + let mut result : bool = false; + for i in 1..l { + let mid1 : usize = start1 + i; + let mid2 : usize = start2 + i; + + println!("{}i={},mid1={}, mid2={}",pad, i, mid1, mid2); + if Self::is_scramble_topdown(s1, start1, mid1, s2, start2, mid2, cache, level+1) && + Self::is_scramble_topdown(s1, mid1, end1, s2, mid2, end2, cache, level + 1) { + result = true; + break; + } + + let mid1 : usize = start1 + i; + let mid2 : usize = end2 - i; + + println!("{}i={},mid1={}, mid2={}",pad, i, mid1, mid2); + if Self::is_scramble_topdown(s1, start1, mid1, s2, mid2, end2, cache, level + 1) && + Self::is_scramble_topdown(s1, mid1, end1, s2, start2, mid2, cache, level+1) { + result = true; + break; + } + + } + cache.insert((start1, start2, l), result); + println!("{}start1={}, end1={}, start2={}, end2={}, result={}", pad, start1, end1, start2, end2, result); + result + } + + pub fn is_scramble(s1: String, s2: String) -> bool { + let s1 : Vec = s1.chars().collect(); + let s2 : Vec = s2.chars().collect(); + let mut cache : HashMap<(usize, usize, usize), bool> = HashMap::new(); + Self::is_scramble_topdown(&s1, 0, s1.len(), &s2, 0, s2.len(), &mut cache, 0) + } + + pub fn is_scramble_bottomup(s1: String, s2: String) -> bool { + if s1.len() != s2.len() {return false;} + let l : usize = s1.len(); + // scrambled[k][i][j] denote whether s1[i..i+k] can be scrambled from s2[i..i+k]. + let mut scrambled : Vec>> = vec![vec![vec![false; l]; l]; l + 1]; + let s1 : Vec = s1.chars().collect(); + let s2 : Vec = s2.chars().collect(); + for k in 1..=l { + for i in 0..=(l-k) { + for j in 0..=(l-k) { + if k == 1 { + scrambled[k][i][j] = s1[i] == s2[j]; + } else { + for m in 1..=k-1 { + if scrambled[m][i][j] && scrambled[k-m][i+m][j+m] { + scrambled[k][i][j] = true; + break; + } + + if scrambled[m][i][j+k-m] && scrambled[k-m][i+m][j] { + scrambled[k][i][j] = true; + break; + } + } + } + } + } + } + + scrambled[l][0][0] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_87() { + // assert!(Solution::is_scramble("great".to_owned(), "rgeat".to_owned())); + // assert!(!Solution::is_scramble("abcde".to_owned(), "caebd".to_owned())); + + assert!(Solution::is_scramble("abcd".to_owned(), "cdab".to_owned())); + } +} diff --git a/src/problem/p0089_gray_code.rs b/src/problem/p0089_gray_code.rs new file mode 100644 index 00000000..b065e73d --- /dev/null +++ b/src/problem/p0089_gray_code.rs @@ -0,0 +1,81 @@ +/** + * [89] Gray Code + * + * An n-bit gray code sequence is a sequence of 2^n integers where: + * + * Every integer is in the inclusive range [0, 2^n - 1], + * The first integer is 0, + * An integer appears no more than once in the sequence, + * The binary representation of every pair of adjacent integers differs by exactly one bit, and + * The binary representation of the first and last integers differs by exactly one bit. + * + * Given an integer n, return any valid n-bit gray code sequence. + * + * Example 1: + * + * Input: n = 2 + * Output: [0,1,3,2] + * Explanation: + * The binary representation of [0,1,3,2] is [00,01,11,10]. + * - 00 and 01 differ by one bit + * - 01 and 11 differ by one bit + * - 11 and 10 differ by one bit + * - 10 and 00 differ by one bit + * [0,2,3,1] is also a valid gray code sequence, whose binary representation is [00,10,11,01]. + * - 00 and 10 differ by one bit + * - 10 and 11 differ by one bit + * - 11 and 01 differ by one bit + * - 01 and 00 differ by one bit + * + * Example 2: + * + * Input: n = 1 + * Output: [0,1] + * + * + * Constraints: + * + * 1 <= n <= 16 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/gray-code/ +// discuss: https://leetcode.com/problems/gray-code/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn gray_code(n: i32) -> Vec { + let n : usize = n as usize; + let count : usize = 1 << n; + let mut result : Vec = vec![]; + for i in 0..count { + let mut num : i32 = 0; + for bit_pos in 0..n { + let period : usize = 1 << (bit_pos + 2); + if (1 << bit_pos) <= i % period && i % period < period - (1 << bit_pos) { + num |= 1 << bit_pos; + } + } + + result.push(num); + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_89() { + assert_eq!(Solution::gray_code(2), vec![0, 1, 3, 2]); + assert_eq!(Solution::gray_code(1), vec![0, 1]); + assert_eq!(Solution::gray_code(0), vec![0]); + assert_eq!(Solution::gray_code(3), vec![0, 1, 3, 2, 6, 7, 5, 4]); + } +} diff --git a/src/problem/p0090_subsets_ii.rs b/src/problem/p0090_subsets_ii.rs new file mode 100644 index 00000000..901c1d79 --- /dev/null +++ b/src/problem/p0090_subsets_ii.rs @@ -0,0 +1,88 @@ +/** + * [90] Subsets II + * + * Given an integer array nums that may contain duplicates, return all possible subsets (the power set). + * The solution set must not contain duplicate subsets. Return the solution in any order. + * + * Example 1: + * Input: nums = [1,2,2] + * Output: [[],[1],[1,2],[1,2,2],[2],[2,2]] + * Example 2: + * Input: nums = [0] + * Output: [[],[0]] + * + * Constraints: + * + * 1 <= nums.length <= 10 + * -10 <= nums[i] <= 10 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/subsets-ii/ +// discuss: https://leetcode.com/problems/subsets-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn backtrack_helper

(result : &mut Vec>, tmp : &mut Vec, elements : &Vec, predicate: P, start : usize, no_dup : bool, element_reusable : bool) where P:Fn(&Vec)->(bool, bool) + Copy { + // is_sorted() is only supported in nightly-built rust + // if no_dup && !elements.is_sorted() { + // panic!("Elements must be presorted to deduplicate."); + // } + let n : usize = elements.len(); + let (valid , backtrack) = predicate(tmp); + if valid { + result.push(tmp.clone()); + } + if backtrack { + for i in start..n { + let backtrack : bool = if !no_dup {true} else if i==start{true}else if elements[i-1] != elements[i] {true}else{false}; + + if backtrack { + tmp.push(elements[i]); + let next_start = if element_reusable { i } else { i+1 }; + Self::backtrack_helper(result, tmp, elements, predicate, next_start, no_dup, element_reusable); + tmp.pop(); + } + } + } + } + + pub fn subsets_with_dup(mut nums: Vec) -> Vec> { + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let element_reusable = false; + let no_dup = true; + nums.sort(); + + let predicate = |tmp : &Vec|{ (true, true) }; + Self::backtrack_helper(&mut result, &mut tmp, &nums, predicate, 0, no_dup, element_reusable); + result + } + +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_90() { + assert_eq!( + Solution::subsets_with_dup(vec![1, 2, 2]), + vec![ + vec![], + vec![1], + vec![1, 2], + vec![1, 2, 2], + vec![2], + vec![2, 2], + ] + ); + // assert_eq!(Solution::subsets_with_dup(vec![1]), vec![vec![], vec![1],]); + // assert_eq!(Solution::subsets_with_dup(vec![]), vec![vec![],]); + } +} diff --git a/src/problem/p0091_decode_ways.rs b/src/problem/p0091_decode_ways.rs new file mode 100644 index 00000000..8d4721e8 --- /dev/null +++ b/src/problem/p0091_decode_ways.rs @@ -0,0 +1,110 @@ +/** + * [91] Decode Ways + * + * A message containing letters from A-Z can be encoded into numbers using the following mapping: + * + * 'A' -> "1" + * 'B' -> "2" + * ... + * 'Z' -> "26" + * + * To decode an encoded message, all the digits must be grouped then mapped back into letters using the reverse of the mapping above (there may be multiple ways). For example, "11106" can be mapped into: + * + * "AAJF" with the grouping (1 1 10 6) + * "KJF" with the grouping (11 10 6) + * + * Note that the grouping (1 11 06) is invalid because "06" cannot be mapped into 'F' since "6" is different from "06". + * Given a string s containing only digits, return the number of ways to decode it. + * The answer is guaranteed to fit in a 32-bit integer. + * + * Example 1: + * + * Input: s = "12" + * Output: 2 + * Explanation: "12" could be decoded as "AB" (1 2) or "L" (12). + * + * Example 2: + * + * Input: s = "226" + * Output: 3 + * Explanation: "226" could be decoded as "BZ" (2 26), "VF" (22 6), or "BBF" (2 2 6). + * + * Example 3: + * + * Input: s = "0" + * Output: 0 + * Explanation: There is no character that is mapped to a number starting with 0. + * The only valid mappings with 0 are 'J' -> "10" and 'T' -> "20", neither of which start with 0. + * Hence, there are no valid ways to decode this since all digits need to be mapped. + * + * Example 4: + * + * Input: s = "06" + * Output: 0 + * Explanation: "06" cannot be mapped to "F" because of the leading zero ("6" is different from "06"). + * + * + * Constraints: + * + * 1 <= s.length <= 100 + * s contains only digits and may contain leading zero(s). + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/decode-ways/ +// discuss: https://leetcode.com/problems/decode-ways/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn num_decodings(s: String) -> i32 { + let mut result : Vec = vec![0;s.len()+1]; + result[s.len()] = 1; + + for i in (0..s.len()).rev() { + + match((s.chars().nth(i), s.chars().nth(i+1))) { + (Some('0'), _) => {result[i] = 0}, + (Some(_), None) => { + result[i] = 1 + }, + + (Some('3'), Some(_)) | (Some('4'), Some(_)) | + (Some('5'), Some(_)) | (Some('6'), Some(_)) | + (Some('7'), Some(_)) | (Some('8'), Some(_)) | + (Some('9'), Some(_)) | + (Some('2'), Some('7')) | + (Some('2'), Some('8')) | (Some('2'), Some('9')) + => {result[i] = result[i+1]}, + + (Some('1'), _) | (Some('2'), Some('0')) | + (Some('2'), Some('1')) | (Some('2'), Some('2')) | + (Some('2'), Some('3')) | (Some('2'), Some('4')) | + (Some('2'), Some('5')) | (Some('2'), Some('6')) + => {result[i] = result[i+1] + result[i+2]}, + + _ => {panic!("Unrecognized case at {}", i)} + + }; + } + println!("result = {:?}", result); + result[0] + } + +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_91() { + assert_eq!( + Solution::num_decodings( + "12".to_owned() + ), 2); + } +} diff --git a/src/problem/p0092_reverse_linked_list_ii.rs b/src/problem/p0092_reverse_linked_list_ii.rs new file mode 100644 index 00000000..1caa5cec --- /dev/null +++ b/src/problem/p0092_reverse_linked_list_ii.rs @@ -0,0 +1,115 @@ +/** + * [92] Reverse Linked List II + * + * Given the head of a singly linked list and two integers left and right where left <= right, reverse the nodes of the list from position left to position right, and return the reversed list. + * + * Example 1: + * + * Input: head = [1,2,3,4,5], left = 2, right = 4 + * Output: [1,4,3,2,5] + * + * Example 2: + * + * Input: head = [5], left = 1, right = 1 + * Output: [5] + * + * + * Constraints: + * + * The number of nodes in the list is n. + * 1 <= n <= 500 + * -500 <= Node.val <= 500 + * 1 <= left <= right <= n + * + * + * Follow up: Could you do it in one pass? + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/reverse-linked-list-ii/ +// discuss: https://leetcode.com/problems/reverse-linked-list-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + fn reverse(mut head : Option>) -> Option> { + let mut reversed : Option> = None; + + while let Some(mut node) = head { + head = node.next; + node.next = reversed; + reversed = Some(node); + } + + reversed + } + + pub fn reverse_between(head: Option>, left: i32, right: i32) -> Option> { + let left : usize = left as usize; + let right : usize = right as usize; + + let mut fake_head : ListNode = ListNode::new(0); + fake_head.next = head; + + let mut front_tail : &mut ListNode = &mut fake_head; + + for i in 0..(left-1) { + front_tail = front_tail.next.as_mut().unwrap(); + } + + let mut to_reversed : Box = front_tail.next.take().unwrap(); + + let mut reversed_tail : &mut ListNode = &mut to_reversed; + for i in 0..(right - left) { + reversed_tail = reversed_tail.next.as_mut().unwrap(); + } + + let to_append : Option> = reversed_tail.next.take(); + + let mut reversed : Box = Self::reverse(Some(to_reversed)).unwrap(); + + let mut reversed_tail : &mut ListNode = &mut reversed; + while let Some(ref mut next_node) = reversed_tail.next { + reversed_tail = next_node; + } + reversed_tail.next = to_append; + + let mut front_tail : &mut ListNode = &mut fake_head; + while let Some(ref mut next_node) = front_tail.next { + front_tail = next_node; + } + front_tail.next = Some(reversed); + + fake_head.next + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_92() { + assert_eq!(Solution::reverse_between(linked![1,2,3,4,5],2,4), linked![1,4,3,2,5]); + assert_eq!(Solution::reverse_between(linked![5],1,1), linked![5]); + } +} diff --git a/src/problem/p0093_restore_ip_addresses.rs b/src/problem/p0093_restore_ip_addresses.rs new file mode 100644 index 00000000..0de6ef37 --- /dev/null +++ b/src/problem/p0093_restore_ip_addresses.rs @@ -0,0 +1,92 @@ +/** + * [93] Restore IP Addresses + * + * Given a string s containing only digits, return all possible valid IP addresses that can be obtained from s. You can return them in any order. + * A valid IP address consists of exactly four integers, each integer is between 0 and 255, separated by single dots and cannot have leading zeros. For example, "0.1.2.201" and "192.168.1.1" are valid IP addresses and "0.011.255.245", "192.168.1.312" and "192.168@1.1" are invalid IP addresses. + * + * Example 1: + * Input: s = "25525511135" + * Output: ["255.255.11.135","255.255.111.35"] + * Example 2: + * Input: s = "0000" + * Output: ["0.0.0.0"] + * Example 3: + * Input: s = "1111" + * Output: ["1.1.1.1"] + * Example 4: + * Input: s = "010010" + * Output: ["0.10.0.10","0.100.1.0"] + * Example 5: + * Input: s = "101023" + * Output: ["1.0.10.23","1.0.102.3","10.1.0.23","10.10.2.3","101.0.2.3"] + * + * Constraints: + * + * 0 <= s.length <= 3000 + * s consists of digits only. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/restore-ip-addresses/ +// discuss: https://leetcode.com/problems/restore-ip-addresses/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn helper(result : &mut Vec, tmp : &mut Vec, cur_pos : usize, chars : &Vec) { + let l : usize = chars.len(); + if cur_pos == l && tmp.len() == 4 { + result.push(tmp.join(".")); + return; + } else if cur_pos == l || tmp.len() == 4 { + return; + } + + tmp.push(chars[cur_pos..cur_pos+1].iter().collect()); + Self::helper(result, tmp, cur_pos + 1, chars); + tmp.pop(); + + if chars[cur_pos] != '0' && cur_pos + 1 < l { + tmp.push(chars[cur_pos..cur_pos+2].iter().cloned().collect()); + Self::helper(result, tmp, cur_pos + 2, chars); + tmp.pop(); + } + + if chars[cur_pos] != '0' && cur_pos + 2 < l { + let next_3 : String = chars[cur_pos..cur_pos+3].iter().cloned().collect(); + if next_3.parse::().unwrap() <= 255 { + tmp.push(next_3); + Self::helper(result, tmp, cur_pos + 3, chars); + tmp.pop(); + } + } + } + + pub fn restore_ip_addresses(s: String) -> Vec { + let s : Vec = s.chars().collect(); + let mut result : Vec = vec![]; + let mut tmp : Vec = vec![]; + + Self::helper(&mut result, &mut tmp, 0, &s); + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_93() { + assert_eq!(Solution::restore_ip_addresses("25525511135".to_owned()), vec!["255.255.11.135","255.255.111.35"]); + + assert_eq!(Solution::restore_ip_addresses("0000".to_owned()), vec!["0.0.0.0"]); + + assert_eq!(Solution::restore_ip_addresses("1111".to_owned()), vec!["1.1.1.1"]); + + assert_eq!(Solution::restore_ip_addresses("010010".to_owned()), vec!["0.10.0.10","0.100.1.0"]); + } +} diff --git a/src/problem/p0094_binary_tree_inorder_traversal.rs b/src/problem/p0094_binary_tree_inorder_traversal.rs new file mode 100644 index 00000000..684933dd --- /dev/null +++ b/src/problem/p0094_binary_tree_inorder_traversal.rs @@ -0,0 +1,103 @@ +/** + * [94] Binary Tree Inorder Traversal + * + * Given the root of a binary tree, return the inorder traversal of its nodes' values. + * + * Example 1: + * + * Input: root = [1,null,2,3] + * Output: [1,3,2] + * + * Example 2: + * + * Input: root = [] + * Output: [] + * + * Example 3: + * + * Input: root = [1] + * Output: [1] + * + * Example 4: + * + * Input: root = [1,2] + * Output: [2,1] + * + * Example 5: + * + * Input: root = [1,null,2] + * Output: [1,2] + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 100]. + * -100 <= Node.val <= 100 + * + * + * Follow up: + * Recursive solution is trivial, could you do it iteratively? + * + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/binary-tree-inorder-traversal/ +// discuss: https://leetcode.com/problems/binary-tree-inorder-traversal/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn inorder_traversal(root: Option>>) -> Vec { + match(root) { + None=>{vec![]}, + Some(node)=>{ + let mut left_vec = Self::inorder_traversal(node.borrow_mut().left.take()); + let mut right_vec = Self::inorder_traversal(node.borrow_mut().right.take()); + left_vec.extend(vec![node.borrow().val]); + left_vec.extend(right_vec); + left_vec + } + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_94() { + assert_eq!( + Solution::inorder_traversal(tree![1, null, 2, 3]), + vec![1, 3, 2] + ); + assert_eq!( + Solution::inorder_traversal(tree![1, 2, 3, 4, 5, 6, 7]), + vec![4, 2, 5, 1, 6, 3, 7] + ); + } +} diff --git a/src/problem/p0095_unique_binary_search_trees_ii.rs b/src/problem/p0095_unique_binary_search_trees_ii.rs new file mode 100644 index 00000000..8af1918c --- /dev/null +++ b/src/problem/p0095_unique_binary_search_trees_ii.rs @@ -0,0 +1,92 @@ +/** + * [95] Unique Binary Search Trees II + * + * Given an integer n, return all the structurally unique BST's (binary search trees), which has exactly n nodes of unique values from 1 to n. Return the answer in any order. + * + * Example 1: + * + * Input: n = 3 + * Output: [[1,null,2,null,3],[1,null,3,2],[2,1,3],[3,1,null,null,2],[3,2,null,1]] + * + * Example 2: + * + * Input: n = 1 + * Output: [[1]] + * + * + * Constraints: + * + * 1 <= n <= 8 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/unique-binary-search-trees-ii/ +// discuss: https://leetcode.com/problems/unique-binary-search-trees-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn generate_trees(n: i32) -> Vec>>> { + let n = n as usize; + let mut matrix : Vec>>>>> = vec![vec![vec![];n+1];n+1]; + for i in 0..n+1 { + matrix[i][i].push(None); + } + for l in 1..n+1 { + let mut start = 0; + while start + l <= n { + let end : usize = start + l; + let mut this_result = vec![]; + for mid in (start..end) { + + for left_tree in matrix[start][mid].iter() { + for right_tree in matrix[mid+1][end].iter() { + let mut node : TreeNode = TreeNode::new((mid + 1) as i32); + node.left = left_tree.clone(); + node.right = right_tree.clone(); + this_result.push(Some(Rc::new(RefCell::new(node)))); + } + } + } + + // println!("start={}, end={}, result.len={}", start, end, this_result.len()); + matrix[start][end].extend(this_result); + start+=1; + } + } + matrix[0][n].clone() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_95() { + } +} diff --git a/src/problem/p0096_unique_binary_search_trees.rs b/src/problem/p0096_unique_binary_search_trees.rs new file mode 100644 index 00000000..2b04a34f --- /dev/null +++ b/src/problem/p0096_unique_binary_search_trees.rs @@ -0,0 +1,59 @@ +/** + * [96] Unique Binary Search Trees + * + * Given an integer n, return the number of structurally unique BST's (binary search trees) which has exactly n nodes of unique values from 1 to n. + * + * Example 1: + * + * Input: n = 3 + * Output: 5 + * + * Example 2: + * + * Input: n = 1 + * Output: 1 + * + * + * Constraints: + * + * 1 <= n <= 19 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/unique-binary-search-trees/ +// discuss: https://leetcode.com/problems/unique-binary-search-trees/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn num_trees(n: i32) -> i32 { + let mut result = vec![]; + + result.push(1); + result.push(1); + for i in 2..=n { + let mut sum = 0; + for j in 0..i { + let jj = i-1-j; + sum += result.get(j as usize).unwrap() * result.get(jj as usize).unwrap(); + } + result.push(sum); + } + result[n as usize] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_96() { + assert_eq!(Solution::num_trees(2), 2); + assert_eq!(Solution::num_trees(3), 5); + + } +} diff --git a/src/problem/p0097_interleaving_string.rs b/src/problem/p0097_interleaving_string.rs new file mode 100644 index 00000000..3c3fe22f --- /dev/null +++ b/src/problem/p0097_interleaving_string.rs @@ -0,0 +1,112 @@ +/** + * [97] Interleaving String + * + * Given strings s1, s2, and s3, find whether s3 is formed by an interleaving of s1 and s2. + * An interleaving of two strings s and t is a configuration where they are divided into non-empty substrings such that: + * + * s = s1 + s2 + ... + sn + * t = t1 + t2 + ... + tm + * |n - m| <= 1 + * The interleaving is s1 + t1 + s2 + t2 + s3 + t3 + ... or t1 + s1 + t2 + s2 + t3 + s3 + ... + * + * Note: a + b is the concatenation of strings a and b. + * + * Example 1: + * + * Input: s1 = "aabcc", s2 = "dbbca", s3 = "aadbbcbcac" + * Output: true + * + * Example 2: + * + * Input: s1 = "aabcc", s2 = "dbbca", s3 = "aadbbbaccc" + * Output: false + * + * Example 3: + * + * Input: s1 = "", s2 = "", s3 = "" + * Output: true + * + * + * Constraints: + * + * 0 <= s1.length, s2.length <= 100 + * 0 <= s3.length <= 200 + * s1, s2, and s3 consist of lowercase English letters. + * + * + * Follow up: Could you solve it using only O(s2.length) additional memory space? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/interleaving-string/ +// discuss: https://leetcode.com/problems/interleaving-string/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + fn match_char(s1 : &Vec, s2 : &Vec, s3 : &Vec, s1_pos : usize, s2_pos : usize, s3_pos : usize) -> bool { + // println!("s1[{}]={},s2[{}]={},s3[{}]={}", s1_pos, s1[s1_pos], s2_pos, s1[s2_pos], s3_pos, s3[s3_pos]); + println!("s1[{}],s2[{}],s3[{}]", s1_pos, s2_pos, s3_pos); + if s3_pos == s3.len() {return true;} + + + if s1_pos < s1.len() && s2_pos < s2.len() && s3[s3_pos] == s1[s1_pos] && s3[s3_pos] == s2[s2_pos] { + Self::match_char(s1, s2, s3, s1_pos+1, s2_pos, s3_pos+1) || + Self::match_char(s1, s2, s3, s1_pos, s2_pos+1, s3_pos+1) + } else if s1_pos < s1.len() && s3[s3_pos] == s1[s1_pos] { + Self::match_char(s1, s2, s3, s1_pos+1, s2_pos, s3_pos+1) + } else if s2_pos < s2.len() && s3[s3_pos] == s2[s2_pos] { + Self::match_char(s1, s2, s3, s1_pos, s2_pos+1, s3_pos+1) + } else { + false + } + } + + pub fn is_interleave(s1: String, s2: String, s3: String) -> bool { + if s1.len() + s2.len() != s3.len() { + return false; + } + + let s1 : Vec = s1.chars().collect(); + let s2 : Vec = s2.chars().collect(); + let s3 : Vec = s3.chars().collect(); + Self::match_char(&s1, &s2, &s3, 0, 0, 0) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_97() { + assert_eq!( + Solution::is_interleave( + "aabcc".to_owned(), + "dbbca".to_owned(), + "aadbbcbcac".to_owned() + ), + true + ); + assert_eq!( + Solution::is_interleave( + "aabcc".to_owned(), + "dbbca".to_owned(), + "aadbbbaccc".to_owned() + ), + false + ); + assert_eq!( + Solution::is_interleave("a".to_owned(), "b".to_owned(), "a".to_owned()), + false + ); + + assert_eq!( + Solution::is_interleave("aa".to_owned(), "aa".to_owned(), "aaaa".to_owned()), + true + ); + } +} diff --git a/src/problem/p0098_validate_binary_search_tree.rs b/src/problem/p0098_validate_binary_search_tree.rs new file mode 100644 index 00000000..56082ff2 --- /dev/null +++ b/src/problem/p0098_validate_binary_search_tree.rs @@ -0,0 +1,119 @@ +/** + * [98] Validate Binary Search Tree + * + * Given the root of a binary tree, determine if it is a valid binary search tree (BST). + * A valid BST is defined as follows: + * + * The left subtree of a node contains only nodes with keys less than the node's key. + * The right subtree of a node contains only nodes with keys greater than the node's key. + * Both the left and right subtrees must also be binary search trees. + * + * + * Example 1: + * + * Input: root = [2,1,3] + * Output: true + * + * Example 2: + * + * Input: root = [5,1,4,null,null,3,6] + * Output: false + * Explanation: The root node's value is 5 but its right child's value is 4. + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [1, 10^4]. + * -2^31 <= Node.val <= 2^31 - 1 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/validate-binary-search-tree/ +// discuss: https://leetcode.com/problems/validate-binary-search-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn helper(root: Option>>) -> (bool, Option, Option) { + match root { + None => (true, None, None), + Some(node) => { + let (left_valid, left_min, left_max) + = Self::helper(node.borrow().left.clone()); + let (right_valid, right_min, right_max) + = Self::helper(node.borrow().right.clone()); + let mut valid = left_valid && right_valid; + + let (my_min, my_max):(i32, i32); + if let Some(left_max_val) = left_max { + valid = valid && left_max_val < node.borrow().val; + } + + if let Some(right_min_val) = right_min { + valid = valid && node.borrow().val < right_min_val; + } + + if let Some(left_min_val) = left_min { + my_min = left_min_val; + } else { + my_min = node.borrow().val; + } + + if let Some(right_max_val) = right_max { + my_max = right_max_val; + } else { + my_max = node.borrow().val; + } + + (valid, Some(my_min), Some(my_max)) + } + } + } + + pub fn is_valid_bst(root: Option>>) -> bool { + let (valid, _, _) = Self::helper(root); + valid + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_98() { + assert_eq!( + Solution::is_valid_bst(tree![5, 1, 4, null, null, 3, 6]), + false + ); + assert_eq!(Solution::is_valid_bst(tree![2, 1, 3]), true); + assert_eq!( + Solution::is_valid_bst(tree![10, 5, 15, null, null, 6, 20]), + false + ); + } +} diff --git a/src/problem/p0099_recover_binary_search_tree.rs b/src/problem/p0099_recover_binary_search_tree.rs new file mode 100644 index 00000000..58cc9f34 --- /dev/null +++ b/src/problem/p0099_recover_binary_search_tree.rs @@ -0,0 +1,117 @@ +/** + * [99] Recover Binary Search Tree + * + * You are given the root of a binary search tree (BST), where exactly two nodes of the tree were swapped by mistake. Recover the tree without changing its structure. + * Follow up: A solution using O(n) space is pretty straight forward. Could you devise a constant space solution? + * + * Example 1: + * + * Input: root = [1,3,null,null,2] + * Output: [3,1,null,null,2] + * Explanation: 3 cannot be a left child of 1 because 3 > 1. Swapping 1 and 3 makes the BST valid. + * + * Example 2: + * + * Input: root = [3,1,4,null,null,2] + * Output: [2,1,4,null,null,3] + * Explanation: 2 cannot be in the right subtree of 3 because 2 < 3. Swapping 2 and 3 makes the BST valid. + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [2, 1000]. + * -2^31 <= Node.val <= 2^31 - 1 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/recover-binary-search-tree/ +// discuss: https://leetcode.com/problems/recover-binary-search-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn inorder(root: &Option>>) -> Vec>> { + let mut result = vec![]; + if root.is_some() { + result.extend(Self::inorder(&root.as_ref().unwrap().borrow().left)); + result.push(Rc::clone(root.as_ref().unwrap())); + result.extend(Self::inorder(&root.as_ref().unwrap().borrow().right)); + } + result + } + + pub fn recover_tree(root: &mut Option>>) { + let mut nodes = Self::inorder(&root); + let mut first_higher : Option>> = None; + let mut last_lower = Rc::clone(nodes.get(0).unwrap()); + let n = nodes.len(); + for i in 0..n { + if i == 0 { + if nodes[i].borrow().val > nodes[i+1].borrow().val && first_higher.is_none() { + first_higher = Some(Rc::clone(nodes.get(i).unwrap())); + } + } else if i == n - 1 { + if nodes[i-1].borrow().val > nodes[i].borrow().val { + last_lower = Rc::clone(nodes.get(i).unwrap()); + } + + } else { + if nodes[i-1].borrow().val > nodes[i].borrow().val && nodes[i].borrow().val < nodes[i+1].borrow().val { + last_lower = Rc::clone(nodes.get(i).unwrap()); + } + + if nodes[i-1].borrow().val < nodes[i].borrow().val && nodes[i].borrow().val > nodes[i+1].borrow().val && first_higher.is_none() { + first_higher = Some(Rc::clone(nodes.get(i).unwrap())); + } + } + // println!("nodes[{}]={}", i, nodes[i].borrow().val); + } + + let first_higher = first_higher.unwrap(); + // println!("higher={}", first_higher.borrow().val); + // println!("lower={}", last_lower.borrow().val); + let tmp = first_higher.borrow().val; + first_higher.borrow_mut().val = last_lower.borrow().val; + last_lower.borrow_mut().val = tmp; + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_99() { + // let mut tree = tree![3, 1, 4, null, null, 2]; + // Solution::recover_tree(&mut tree); + // assert_eq!(tree, tree![2, 1, 4, null, null, 3]); + + let mut tree = tree![2, 6, 5, null, null, 3, 1, null, 4]; + Solution::recover_tree(&mut tree); + assert_eq!(tree, tree![2, 1, 5, null, null, 3, 6, null, 4]); + } +} diff --git a/src/problem/p0100_same_tree.rs b/src/problem/p0100_same_tree.rs new file mode 100644 index 00000000..b238e94c --- /dev/null +++ b/src/problem/p0100_same_tree.rs @@ -0,0 +1,89 @@ +/** + * [100] Same Tree + * + * Given the roots of two binary trees p and q, write a function to check if they are the same or not. + * Two binary trees are considered the same if they are structurally identical, and the nodes have the same value. + * + * Example 1: + * + * Input: p = [1,2,3], q = [1,2,3] + * Output: true + * + * Example 2: + * + * Input: p = [1,2], q = [1,null,2] + * Output: false + * + * Example 3: + * + * Input: p = [1,2,1], q = [1,1,2] + * Output: false + * + * + * Constraints: + * + * The number of nodes in both trees is in the range [0, 100]. + * -10^4 <= Node.val <= 10^4 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/same-tree/ +// discuss: https://leetcode.com/problems/same-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn is_same(p: &Option>>, q: &Option>>) -> bool { + if p.is_none() && q.is_none() { + true + } else if p.is_none() || q.is_none() { + false + } else if p.as_ref().unwrap().borrow().val != q.as_ref().unwrap().borrow().val { + false + } else { + Self::is_same(&p.as_ref().unwrap().borrow().left, &q.as_ref().unwrap().borrow().left) && + Self::is_same(&p.as_ref().unwrap().borrow().right, &q.as_ref().unwrap().borrow().right) + } + } + + pub fn is_same_tree(p: Option>>, q: Option>>) -> bool { + Self::is_same(&p, &q) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_100() { + assert_eq!( + Solution::is_same_tree(tree![1, 2, 3, 4, null, 5], tree![1, 2, 3, 4, null, 5]), + true + ) + } +} diff --git a/src/problem/p0101_symmetric_tree.rs b/src/problem/p0101_symmetric_tree.rs new file mode 100644 index 00000000..5c95ee24 --- /dev/null +++ b/src/problem/p0101_symmetric_tree.rs @@ -0,0 +1,93 @@ +/** + * [101] Symmetric Tree + * + * Given the root of a binary tree, check whether it is a mirror of itself (i.e., symmetric around its center). + * + * Example 1: + * + * Input: root = [1,2,2,3,4,4,3] + * Output: true + * + * Example 2: + * + * Input: root = [1,2,2,null,3,null,3] + * Output: false + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [1, 1000]. + * -100 <= Node.val <= 100 + * + * + * Follow up: Could you solve it both recursively and iteratively? + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/symmetric-tree/ +// discuss: https://leetcode.com/problems/symmetric-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn is_mirror(left: &Option>>, + right: &Option>>) -> bool { + if left.is_none() && right.is_none() { + true + } else if left.is_none() || right.is_none() { + false + } else { + left.as_ref().unwrap().borrow().val == right.as_ref().unwrap().borrow().val + && Self::is_mirror(&left.as_ref().unwrap().borrow().left, &right.as_ref().unwrap().borrow().right) + && Self::is_mirror(&left.as_ref().unwrap().borrow().right, &right.as_ref().unwrap().borrow().left) + } + } + + pub fn is_symmetric(root: Option>>) -> bool { + if root.is_none() { + true + } else { + Self::is_mirror(&root.as_ref().unwrap().borrow().left, + &root.as_ref().unwrap().borrow().right + ) + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_101() { + assert_eq!(Solution::is_symmetric(tree![1, 2, 2, 3, 4, 4, 3]), true); + assert_eq!( + Solution::is_symmetric(tree![1, 2, 2, null, 3, null, 3]), + false + ); + assert_eq!(Solution::is_symmetric(tree![]), true); + } +} diff --git a/src/problem/p0103_binary_tree_zigzag_level_order_traversal.rs b/src/problem/p0103_binary_tree_zigzag_level_order_traversal.rs new file mode 100644 index 00000000..773dd87a --- /dev/null +++ b/src/problem/p0103_binary_tree_zigzag_level_order_traversal.rs @@ -0,0 +1,120 @@ +/** + * [103] Binary Tree Zigzag Level Order Traversal + * + * Given the root of a binary tree, return the zigzag level order traversal of its nodes' values. (i.e., from left to right, then right to left for the next level and alternate between). + * + * Example 1: + * + * Input: root = [3,9,20,null,null,15,7] + * Output: [[3],[20,9],[15,7]] + * + * Example 2: + * + * Input: root = [1] + * Output: [[1]] + * + * Example 3: + * + * Input: root = [] + * Output: [] + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 2000]. + * -100 <= Node.val <= 100 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/binary-tree-zigzag-level-order-traversal/ +// discuss: https://leetcode.com/problems/binary-tree-zigzag-level-order-traversal/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; + +use std::collections::LinkedList; + +impl Solution { + pub fn zigzag_level_order(root: Option>>) -> Vec> { + let mut result : Vec> = vec![]; + if root.is_none() { + return vec![]; + } + + let mut odd_stack: LinkedList>> = LinkedList::new(); + let mut even_stack: LinkedList>> = LinkedList::new(); + + odd_stack.push_back(Rc::clone(root.as_ref().unwrap())); + + loop { + if odd_stack.is_empty() { + break; + } + let mut level : Vec = vec![]; + while let Some(node) = odd_stack.pop_back() { + level.push(node.borrow().val); + if node.borrow().left.is_some() { + even_stack.push_back(Rc::clone(node.borrow().left.as_ref().unwrap())); + } + if node.borrow().right.is_some() { + even_stack.push_back(Rc::clone(node.borrow().right.as_ref().unwrap())); + } + } + result.push(level); + let mut level : Vec = vec![]; + + if even_stack.is_empty() { + break + } + while let Some(node) = even_stack.pop_back() { + level.push(node.borrow().val); + if node.borrow().right.is_some() { + odd_stack.push_back(Rc::clone(node.borrow().right.as_ref().unwrap())); + } + if node.borrow().left.is_some() { + odd_stack.push_back(Rc::clone(node.borrow().left.as_ref().unwrap())); + } + } + result.push(level); + } + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_103() { + assert_eq!( + Solution::zigzag_level_order(tree![3, 9, 20, null, null, 15, 7]), + vec![vec![3], vec![20, 9], vec![15, 7]] + ); + } +} diff --git a/src/problem/p0104_maximum_depth_of_binary_tree.rs b/src/problem/p0104_maximum_depth_of_binary_tree.rs new file mode 100644 index 00000000..07669024 --- /dev/null +++ b/src/problem/p0104_maximum_depth_of_binary_tree.rs @@ -0,0 +1,105 @@ +/** + * [104] Maximum Depth of Binary Tree + * + * Given the root of a binary tree, return its maximum depth. + * + * A binary tree's maximum depth is the number of nodes along the longest path from the root node down to the farthest leaf node. + * + * + * Example 1: + * + * + * Input: root = [3,9,20,null,null,15,7] + * Output: 3 + * + * + * Example 2: + * + * + * Input: root = [1,null,2] + * Output: 2 + * + * + * Example 3: + * + * + * Input: root = [] + * Output: 0 + * + * + * Example 4: + * + * + * Input: root = [0] + * Output: 1 + * + * + * + * Constraints: + * + * + * The number of nodes in the tree is in the range [0, 10^4]. + * -100 <= Node.val <= 100 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/maximum-depth-of-binary-tree/ +// discuss: https://leetcode.com/problems/maximum-depth-of-binary-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +use std::cmp; + +impl Solution { + pub fn helper(node: &Option>>) -> i32 { + return match node { + None => 0, + _ => { + let internal = node.as_ref().unwrap().borrow_mut(); + 1 + cmp::max( + Self::helper(&internal.left), + Self::helper(&internal.right) + ) + }, + } + } + + pub fn max_depth(root: Option>>) -> i32 { + return Self::helper(&root); + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_104() { + assert_eq!(Solution::max_depth(tree![]), 0); + assert_eq!(Solution::max_depth(tree![3, 9, 20, null, null, 15, 7]), 3); + } +} diff --git a/src/problem/p0105_construct_binary_tree_from_preorder_and_inorder_traversal.rs b/src/problem/p0105_construct_binary_tree_from_preorder_and_inorder_traversal.rs new file mode 100644 index 00000000..59fedd8e --- /dev/null +++ b/src/problem/p0105_construct_binary_tree_from_preorder_and_inorder_traversal.rs @@ -0,0 +1,148 @@ +/** + * [105] Construct Binary Tree from Preorder and Inorder Traversal + * + * Given two integer arrays preorder and inorder where preorder is the preorder traversal of a binary tree and inorder is the inorder traversal of the same tree, construct and return the binary tree. + * + * Example 1: + * + * Input: preorder = [3,9,20,15,7], inorder = [9,3,15,20,7] + * Output: [3,9,20,null,null,15,7] + * + * Example 2: + * + * Input: preorder = [-1], inorder = [-1] + * Output: [-1] + * + * + * Constraints: + * + * 1 <= preorder.length <= 3000 + * inorder.length == preorder.length + * -3000 <= preorder[i], inorder[i] <= 3000 + * preorder and inorder consist of unique values. + * Each value of inorder also appears in preorder. + * preorder is guaranteed to be the preorder traversal of the tree. + * inorder is guaranteed to be the inorder traversal of the tree. + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/construct-binary-tree-from-preorder-and-inorder-traversal/ +// discuss: https://leetcode.com/problems/construct-binary-tree-from-preorder-and-inorder-traversal/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn within(l: &Vec, val : i32) -> bool { + for n in l { + if *n == val { + return true; + } + } + false + } + + pub fn helper(pre_order_start : usize, in_order_start : usize, count : usize, preorder: &Vec, inorder: &Vec) -> Option>> { + if count == 0 { + return None; + } + + let root_val = preorder[pre_order_start]; + let root = Rc::new(RefCell::new(TreeNode::new(root_val))); + + let mut right_inorder_start = 0; + let mut left_count = 0; + for i in in_order_start..in_order_start + count { + if inorder[i] == root_val { + right_inorder_start = i+1; + break + } + left_count += 1; + } + let right_count = count - left_count - 1; + root.borrow_mut().left = Self::helper(pre_order_start+1, in_order_start, left_count, preorder, inorder); + root.borrow_mut().right = Self::helper(pre_order_start+1+left_count, right_inorder_start, right_count, preorder, inorder); + + Some(root) + } + + pub fn build_tree(preorder: Vec, inorder: Vec) -> Option>> { + Self::helper(0, 0, preorder.len(), &preorder, &inorder) + // if preorder.len() == 0 { + // return None; + // } + + // let root_val = preorder[0]; + // let root = Rc::new(RefCell::new(TreeNode::new(root_val))); + + // let mut left_inorder: Vec = vec![]; + // let mut right_inorder: Vec = vec![]; + + // let mut found = false; + // for num in inorder { + // if num == root_val { + // found = true + // } else if found { + // right_inorder.push(num); + // } else { + // left_inorder.push(num); + // } + // } + + // let mut left_preorder : Vec = vec![]; + // let mut right_preorder : Vec= vec![]; + // for num in preorder { + // if Self::within(&left_inorder, num) { + // left_preorder.push(num); + // } + // if Self::within(&right_inorder, num) { + // right_preorder.push(num); + // } + // } + + // root.borrow_mut().left = Self::build_tree(left_preorder, left_inorder); + // root.borrow_mut().right = Self::build_tree(right_preorder, right_inorder); + // Some(root) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_105() { + assert_eq!( + Solution::build_tree(vec![3, 9, 20, 15, 7], vec![9, 3, 15, 20, 7]), + tree![3, 9, 20, null, null, 15, 7] + ); + assert_eq!( + Solution::build_tree(vec![3, 20, 7], vec![3, 20, 7]), + tree![3, null, 20, null, 7] + ); + assert_eq!(Solution::build_tree(vec![], vec![]), tree![]); + } +} diff --git a/src/problem/p0106_construct_binary_tree_from_inorder_and_postorder_traversal.rs b/src/problem/p0106_construct_binary_tree_from_inorder_and_postorder_traversal.rs new file mode 100644 index 00000000..0dc47e27 --- /dev/null +++ b/src/problem/p0106_construct_binary_tree_from_inorder_and_postorder_traversal.rs @@ -0,0 +1,122 @@ +/** + * [106] Construct Binary Tree from Inorder and Postorder Traversal + * + * Given two integer arrays inorder and postorder where inorder is the inorder traversal of a binary tree and postorder is the postorder traversal of the same tree, construct and return the binary tree. + * + * Example 1: + * + * Input: inorder = [9,3,15,20,7], postorder = [9,15,7,20,3] + * Output: [3,9,20,null,null,15,7] + * + * Example 2: + * + * Input: inorder = [-1], postorder = [-1] + * Output: [-1] + * + * + * Constraints: + * + * 1 <= inorder.length <= 3000 + * postorder.length == inorder.length + * -3000 <= inorder[i], postorder[i] <= 3000 + * inorder and postorder consist of unique values. + * Each value of postorder also appears in inorder. + * inorder is guaranteed to be the inorder traversal of the tree. + * postorder is guaranteed to be the postorder traversal of the tree. + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/construct-binary-tree-from-inorder-and-postorder-traversal/ +// discuss: https://leetcode.com/problems/construct-binary-tree-from-inorder-and-postorder-traversal/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::{collections::HashMap, rc::Rc}; +use std::cell::RefCell; +impl Solution { + pub fn helper(in_order_start: usize, in_order_end: usize, inorder: &Vec, postorder_pos: &HashMap) -> Option>> { + if in_order_start == in_order_end { + None + } else if in_order_start == in_order_end-1 { + Some(Rc::new(RefCell::new(TreeNode::new(*inorder.get(in_order_start).unwrap())))) + } else if in_order_start < in_order_end-1 { + // locate the element within [in_order_start, in_order_end) + // which appears at the last of postporder_pos + // Record down the element pos in inorder list + let mut lastpost_inorder_pos = in_order_start; + let inorder_num = inorder[in_order_start]; + let mut cur_lastpost_pos = postorder_pos[&inorder_num]; + + for i in in_order_start..in_order_end { + let inorder_num = inorder[i]; + let num_post_pos = postorder_pos[&inorder_num]; + if cur_lastpost_pos < num_post_pos { + cur_lastpost_pos = num_post_pos; + lastpost_inorder_pos = i; + } + } + // println!("in_order_start = {}, in_order_end = {}, lastpost_inorder_pos = {}", in_order_start, in_order_end, lastpost_inorder_pos); + // None + let left = Self::helper(in_order_start, lastpost_inorder_pos, inorder, postorder_pos); + let right = Self::helper(lastpost_inorder_pos+1, in_order_end, + inorder, postorder_pos); + let mut node = TreeNode::new(*inorder.get(lastpost_inorder_pos).unwrap()); + node.left = left; + node.right = right; + + Some(Rc::new(RefCell::new(node))) + + } else { + panic!("Not here"); + None + } + } + pub fn build_tree(inorder: Vec, postorder: Vec) -> Option>> { + let mut postorder_pos = HashMap::new(); + for (i, num) in postorder.iter().enumerate() { + postorder_pos.insert(*num, i); + } + Self::helper(0, inorder.len(), &inorder, &postorder_pos) + // Some(Rc::new(RefCell::new(TreeNode::new(0)))) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_106() { + assert_eq!( + Solution::build_tree(vec![9, 3, 15, 20, 7], vec![9, 15, 7, 20, 3]), + tree![3, 9, 20, null, null, 15, 7] + ); + // assert_eq!( + // Solution::build_tree(vec![3, 20, 7], vec![7, 20, 3]), + // tree![3, null, 20, null, 7] + // ); + // assert_eq!(Solution::build_tree(vec![], vec![]), tree![]); + } +} diff --git a/src/problem/p0107_binary_tree_level_order_traversal_ii.rs b/src/problem/p0107_binary_tree_level_order_traversal_ii.rs new file mode 100644 index 00000000..812e159e --- /dev/null +++ b/src/problem/p0107_binary_tree_level_order_traversal_ii.rs @@ -0,0 +1,116 @@ +/** + * [107] Binary Tree Level Order Traversal II + * + * Given the root of a binary tree, return the bottom-up level order traversal of its nodes' values. (i.e., from left to right, level by level from leaf to root). + * + * Example 1: + * + * Input: root = [3,9,20,null,null,15,7] + * Output: [[15,7],[9,20],[3]] + * + * Example 2: + * + * Input: root = [1] + * Output: [[1]] + * + * Example 3: + * + * Input: root = [] + * Output: [] + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 2000]. + * -1000 <= Node.val <= 1000 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/binary-tree-level-order-traversal-ii/ +// discuss: https://leetcode.com/problems/binary-tree-level-order-traversal-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +use std::collections::VecDeque; + +impl Solution { + pub fn level_order_bottom(root: Option>>) -> Vec> { + + let mut traversed : Vec> = vec![]; + let mut this_level : Vec = vec![]; + let mut last_level = 0usize; + if let Some(ref root_node) = root { + type NodeWithLevel = (Rc>, usize); + let mut queue : VecDeque = VecDeque::new(); + queue.push_back((Rc::clone(root_node), 1)); + + while let Some(head_entry) = queue.pop_front() { + let cur_node : Rc> = head_entry.0; + let cur_level : usize = head_entry.1; + + if cur_level != last_level { + // can be empty when processing the first node + if this_level.len() != 0 { + traversed.push(this_level); + } + this_level = vec![]; + } + + last_level = cur_level; + this_level.push(cur_node.borrow().val); + + // left_node typed with &Rc> + if let Some(left_node) = cur_node.borrow().left.as_ref() { + queue.push_back((Rc::clone(left_node), cur_level+1)); + }; + + // right_node typed with &Rc> + if let Some(right_node) = cur_node.borrow().right.as_ref() { + queue.push_back((Rc::clone(right_node), cur_level+1)); + }; + } + } + + if this_level.len() != 0 { + traversed.push(this_level); + } + traversed.into_iter().rev().collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_107() { + assert_eq!( + Solution::level_order_bottom(tree![3, 9, 20, null, null, 15, 7]), + vec![vec![15, 7], vec![9, 20], vec![3],] + ); + } +} diff --git a/src/problem/p0108_convert_sorted_array_to_binary_search_tree.rs b/src/problem/p0108_convert_sorted_array_to_binary_search_tree.rs new file mode 100644 index 00000000..6bfcae86 --- /dev/null +++ b/src/problem/p0108_convert_sorted_array_to_binary_search_tree.rs @@ -0,0 +1,96 @@ +/** + * [108] Convert Sorted Array to Binary Search Tree + * + * Given an integer array nums where the elements are sorted in ascending order, convert it to a height-balanced binary search tree. + * A height-balanced binary tree is a binary tree in which the depth of the two subtrees of every node never differs by more than one. + * + * Example 1: + * + * Input: nums = [-10,-3,0,5,9] + * Output: [0,-3,9,-10,null,5] + * Explanation: [0,-10,5,null,-3,null,9] is also accepted: + * + * + * Example 2: + * + * Input: nums = [1,3] + * Output: [3,1] + * Explanation: [1,3] and [3,1] are both a height-balanced BSTs. + * + * + * Constraints: + * + * 1 <= nums.length <= 10^4 + * -10^4 <= nums[i] <= 10^4 + * nums is sorted in a strictly increasing order. + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/convert-sorted-array-to-binary-search-tree/ +// discuss: https://leetcode.com/problems/convert-sorted-array-to-binary-search-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn vec2bst_helper(nums : &[i32], size: i32) -> Option>> { + if size <= 0 { + None + } else { + // biase to left half so that mid will not overflow. + let mid = size / 2; + let left_size = mid; + let right_size = size - 1 - mid; + let node = Rc::new(RefCell::new(TreeNode::new(nums[mid as usize]))); + if 0 < mid { + node.borrow_mut().left = Self::vec2bst_helper(&nums[0..(mid as usize)], left_size); + } + + if mid+1 < size { + node.borrow_mut().right = Self::vec2bst_helper(&nums[(mid+1) as usize..], right_size); + } + Some(node) + } + } + + pub fn sorted_array_to_bst(nums: Vec) -> Option>> { + return Self::vec2bst_helper(&nums[..], nums.len() as i32); + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_108() { + assert_eq!( + Solution::sorted_array_to_bst(vec![-10, -3, 0, 5, 9]), + tree![0, -3, 9, -10, null, 5] + ); + assert_eq!(Solution::sorted_array_to_bst(vec![]), tree![]); + } +} diff --git a/src/problem/p0109_convert_sorted_list_to_binary_search_tree.rs b/src/problem/p0109_convert_sorted_list_to_binary_search_tree.rs new file mode 100644 index 00000000..02b16771 --- /dev/null +++ b/src/problem/p0109_convert_sorted_list_to_binary_search_tree.rs @@ -0,0 +1,128 @@ +/** + * [109] Convert Sorted List to Binary Search Tree + * + * Given the head of a singly linked list where elements are sorted in ascending order, convert it to a height balanced BST. + * For this problem, a height-balanced binary tree is defined as a binary tree in which the depth of the two subtrees of every node never differ by more than 1. + * + * Example 1: + * + * Input: head = [-10,-3,0,5,9] + * Output: [0,-3,9,-10,null,5] + * Explanation: One possible answer is [0,-3,9,-10,null,5], which represents the shown height balanced BST. + * + * Example 2: + * + * Input: head = [] + * Output: [] + * + * Example 3: + * + * Input: head = [0] + * Output: [0] + * + * Example 4: + * + * Input: head = [1,3] + * Output: [3,1] + * + * + * Constraints: + * + * The number of nodes in head is in the range [0, 2 * 10^4]. + * -10^5 <= Node.val <= 10^5 + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/convert-sorted-list-to-binary-search-tree/ +// discuss: https://leetcode.com/problems/convert-sorted-list-to-binary-search-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn sorted_list_to_bst(mut head: Option>) -> Option>> { + if head.is_none() { + return None; + } + + let mut l : usize = 1; + let mut node_ptr : &ListNode = head.as_ref().unwrap(); + while let Some(ref next) = node_ptr.next { + node_ptr = next; + l+=1; + } + + if l == 1 { + return Some(Rc::new(RefCell::new(TreeNode::new(node_ptr.val)))); + } + + let mid : usize = l / 2; + let mut first_half_tail : &mut ListNode = head.as_mut().unwrap(); + let mut i : usize = 0; + while i < mid - 1 { + first_half_tail = first_half_tail.next.as_mut().unwrap(); + i+=1; + } + + let mut mid_node : Box = first_half_tail.next.take().unwrap(); + let sec_half : Option> = mid_node.next.take(); + + let mut this_node : TreeNode = TreeNode::new(mid_node.val); + this_node.left = Self::sorted_list_to_bst(head); + this_node.right = Self::sorted_list_to_bst(sec_half); + Some(Rc::new(RefCell::new(this_node))) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_109() { + assert_eq!( + Solution::sorted_list_to_bst(linked![-10, -3, 0, 5, 9]), + tree![0, -3, 9, -10, null, 5] + ); + } +} diff --git a/src/problem/p0110_balanced_binary_tree.rs b/src/problem/p0110_balanced_binary_tree.rs new file mode 100644 index 00000000..d0408b26 --- /dev/null +++ b/src/problem/p0110_balanced_binary_tree.rs @@ -0,0 +1,100 @@ +/** + * [110] Balanced Binary Tree + * + * Given a binary tree, determine if it is height-balanced. + * For this problem, a height-balanced binary tree is defined as: + *

+ * a binary tree in which the left and right subtrees of every node differ in height by no more than 1. + *
+ * + * Example 1: + * + * Input: root = [3,9,20,null,null,15,7] + * Output: true + * + * Example 2: + * + * Input: root = [1,2,2,3,3,null,null,4,4] + * Output: false + * + * Example 3: + * + * Input: root = [] + * Output: true + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 5000]. + * -10^4 <= Node.val <= 10^4 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/balanced-binary-tree/ +// discuss: https://leetcode.com/problems/balanced-binary-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn helper(node: &Option>>) -> (bool, usize) { + if node.is_none() { + (true, 0) + } else { + let (is_left_balanced, left_depth) = Self::helper(&node.as_ref().unwrap().borrow().left); + let (is_right_balanced, right_depth) = Self::helper(&node.as_ref().unwrap().borrow().right); + + let (smaller, larger) = if left_depth < right_depth { + (left_depth, right_depth) + } else { + (right_depth, left_depth) + }; + (is_left_balanced && is_right_balanced && larger - smaller <= 1, larger+1) + } + } + pub fn is_balanced(root: Option>>) -> bool { + let (balanced, _) = Self::helper(&root); + balanced + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_110() { + assert_eq!(Solution::is_balanced(tree![]), true); + assert_eq!( + Solution::is_balanced(tree![3, 9, 20, null, null, 15, 7]), + true + ); + assert_eq!( + Solution::is_balanced(tree![1, 2, 2, 3, 3, null, null, 4, 4]), + false + ); + } +} diff --git a/src/problem/p0111_minimum_depth_of_binary_tree.rs b/src/problem/p0111_minimum_depth_of_binary_tree.rs new file mode 100644 index 00000000..d2bf3d8e --- /dev/null +++ b/src/problem/p0111_minimum_depth_of_binary_tree.rs @@ -0,0 +1,97 @@ +/** + * [111] Minimum Depth of Binary Tree + * + * Given a binary tree, find its minimum depth. + * The minimum depth is the number of nodes along the shortest path from the root node down to the nearest leaf node. + * Note: A leaf is a node with no children. + * + * Example 1: + * + * Input: root = [3,9,20,null,null,15,7] + * Output: 2 + * + * Example 2: + * + * Input: root = [2,null,3,null,4,null,5,null,6] + * Output: 5 + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 10^5]. + * -1000 <= Node.val <= 1000 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/minimum-depth-of-binary-tree/ +// discuss: https://leetcode.com/problems/minimum-depth-of-binary-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +use std::collections::VecDeque; + +impl Solution { + pub fn min_depth(root: Option>>) -> i32 { + let mut last_level = 0; + if let Some(ref root_node) = root { + type NodeWithLevel = (Rc>, usize); + let mut queue : VecDeque = VecDeque::new(); + queue.push_back((Rc::clone(root_node), 1)); + + while let Some(head_entry) = queue.pop_front() { + let cur_node : Rc> = head_entry.0; + let cur_level : usize = head_entry.1; + let mut has_children = false; + // left_node typed with &Rc> + if let Some(left_node) = cur_node.borrow().left.as_ref() { + queue.push_back((Rc::clone(left_node), cur_level+1)); + has_children = true; + }; + + // right_node typed with &Rc> + if let Some(right_node) = cur_node.borrow().right.as_ref() { + queue.push_back((Rc::clone(right_node), cur_level+1)); + has_children = true; + }; + + if !has_children {return cur_level as i32} + last_level = cur_level + } + } + last_level as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_111() { + assert_eq!(Solution::min_depth(tree![3, 9, 20, null, null, 15, 7]), 2); + } +} diff --git a/src/problem/p0112_path_sum.rs b/src/problem/p0112_path_sum.rs new file mode 100644 index 00000000..41256c73 --- /dev/null +++ b/src/problem/p0112_path_sum.rs @@ -0,0 +1,107 @@ +/** + * [112] Path Sum + * + * Given the root of a binary tree and an integer targetSum, return true if the tree has a root-to-leaf path such that adding up all the values along the path equals targetSum. + * A leaf is a node with no children. + * + * Example 1: + * + * Input: root = [5,4,8,11,null,13,4,7,2,null,null,null,1], targetSum = 22 + * Output: true + * + * Example 2: + * + * Input: root = [1,2,3], targetSum = 5 + * Output: false + * + * Example 3: + * + * Input: root = [1,2], targetSum = 0 + * Output: false + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 5000]. + * -1000 <= Node.val <= 1000 + * -1000 <= targetSum <= 1000 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/path-sum/ +// discuss: https://leetcode.com/problems/path-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn helper(root: Rc>, target_sum: i32) -> bool { + let this_val = root.borrow().val; + let next_sum = target_sum - this_val; + + let mut is_leaf = true; + if let Some(left_node) = root.borrow().left.clone() { + is_leaf = false; + if Self::helper(left_node, next_sum) { + return true; + } + } + + if let Some(right_node) = root.borrow().right.clone() { + is_leaf = false; + if Self::helper(right_node, next_sum) { + return true; + } + } + + if is_leaf && next_sum == 0 { + return true; + } else { + return false; + } + } + pub fn has_path_sum(root: Option>>, target_sum: i32) -> bool { + if root.is_none() {false} else { + Self::helper(root.unwrap(), target_sum) + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_112() { + assert_eq!( + Solution::has_path_sum( + tree![5, 4, 8, 11, null, 13, 4, 7, 2, null, null, null, 1], + 22 + ), + true + ); + } +} diff --git a/src/problem/p0113_path_sum_ii.rs b/src/problem/p0113_path_sum_ii.rs new file mode 100644 index 00000000..b4483bde --- /dev/null +++ b/src/problem/p0113_path_sum_ii.rs @@ -0,0 +1,137 @@ +/** + * [113] Path Sum II + * + * Given the root of a binary tree and an integer targetSum, return all root-to-leaf paths where each path's sum equals targetSum. + * A leaf is a node with no children. + * + * Example 1: + * + * Input: root = [5,4,8,11,null,13,4,7,2,null,null,5,1], targetSum = 22 + * Output: [[5,4,11,2],[5,8,4,5]] + * + * Example 2: + * + * Input: root = [1,2,3], targetSum = 5 + * Output: [] + * + * Example 3: + * + * Input: root = [1,2], targetSum = 0 + * Output: [] + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 5000]. + * -1000 <= Node.val <= 1000 + * -1000 <= targetSum <= 1000 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/path-sum-ii/ +// discuss: https://leetcode.com/problems/path-sum-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::{borrow::BorrowMut, rc::Rc}; +use std::cell::RefCell; +impl Solution { + pub fn path_sum(root: Option>>, target_sum: i32) -> Vec> { + let mut result = vec![]; + match(root) { + Some(node)=>{ + let val = node.borrow().val; + let next_sum = target_sum - val; + + let left = (*node).borrow_mut().left.take(); + let right = (*node).borrow_mut().right.take(); + match (left, right) { + (None, None)=>{ + if next_sum == 0 { + result = vec![vec![val]]; + } + }, + (Some(left_node), None)=>{ + // if target_sum == val { + // result = vec![vec![val]]; + // } + + let left_result = Self::path_sum(Some(left_node), next_sum); + for mut left in left_result { + let mut new_left = vec![val]; + new_left.append(&mut left); + result.push(new_left); + } + }, + (None, Some(right_node))=>{ + // if next_sum == 0 { + // result = vec![vec![val]]; + // } + let right_result = Self::path_sum(Some(right_node), next_sum); + for mut right in right_result { + let mut new_right = vec![val]; + new_right.append(&mut right); + result.push(new_right); + } + }, + (Some(left_node), Some(right_node))=>{ + let left_result = Self::path_sum(Some(left_node), next_sum); + let right_result = Self::path_sum(Some(right_node), next_sum); + for mut left in left_result { + let mut new_left = vec![val]; + new_left.append(&mut left); + result.push(new_left); + } + + for mut right in right_result { + let mut new_right = vec![val]; + new_right.append(&mut right); + result.push(new_right); + } + + }, + } + + } + None=>{ + // do nothing + } + }; + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_113() { + assert_eq!( + Solution::path_sum(tree![5, 4, 8, 11, null, 13, 4, 7, 2, null, null, 5, 1], 22), + vec![vec![5, 4, 11, 2], vec![5, 8, 4, 5]] + ) + } +} diff --git a/src/problem/p0114_flatten_binary_tree_to_linked_list.rs b/src/problem/p0114_flatten_binary_tree_to_linked_list.rs new file mode 100644 index 00000000..718d46cc --- /dev/null +++ b/src/problem/p0114_flatten_binary_tree_to_linked_list.rs @@ -0,0 +1,114 @@ +/** + * [114] Flatten Binary Tree to Linked List + * + * Given the root of a binary tree, flatten the tree into a "linked list": + * + * The "linked list" should use the same TreeNode class where the right child pointer points to the next node in the list and the left child pointer is always null. + * The "linked list" should be in the same order as a pre-order traversal of the binary tree. + * + * + * Example 1: + * + * Input: root = [1,2,5,3,4,null,6] + * Output: [1,null,2,null,3,null,4,null,5,null,6] + * + * Example 2: + * + * Input: root = [] + * Output: [] + * + * Example 3: + * + * Input: root = [0] + * Output: [0] + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 2000]. + * -100 <= Node.val <= 100 + * + * + * Follow up: Can you flatten the tree in-place (with O(1) extra space)? + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/flatten-binary-tree-to-linked-list/ +// discuss: https://leetcode.com/problems/flatten-binary-tree-to-linked-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn helper (root : Rc>) -> (Rc>, Rc>) { + let prev_left = root.borrow().left.clone(); + let prev_right = root.borrow().right.clone(); +let mut my_tail = Rc::clone(&root); + my_tail.borrow_mut().left = None; + + if let Some(left_node) = prev_left { + let (left_head, left_tail) = Self::helper(left_node); + root.borrow_mut().right = Some(left_head); + my_tail = left_tail + } + + if let Some(right_node) = prev_right { + let (right_head, right_tail) = Self::helper(right_node); + my_tail.borrow_mut().right = Some(right_head); + my_tail = right_tail; + } + + return (root, my_tail); + } + + pub fn flatten(root: &mut Option>>) { + match(root) { + None => {}, + Some(node) => { + Self::helper(Rc::clone(node)); + } + }; + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_114() { + let mut tree = tree![1, 2, 5, 3, 4, null, 6]; + Solution::flatten(&mut tree); + assert_eq!(tree, tree![1, null, 2, null, 3, null, 4, null, 5, null, 6]); + + let mut tree = tree![1, 2, null, 3]; + Solution::flatten(&mut tree); + assert_eq!(tree, tree![1, null, 2, null, 3]); + + let mut tree = tree![1, null, 2, 3]; + Solution::flatten(&mut tree); + assert_eq!(tree, tree![1, null, 2, null, 3]); + } +} diff --git a/src/problem/p0115_distinct_subsequences.rs b/src/problem/p0115_distinct_subsequences.rs new file mode 100644 index 00000000..7aedcb58 --- /dev/null +++ b/src/problem/p0115_distinct_subsequences.rs @@ -0,0 +1,124 @@ +/** + * [115] Distinct Subsequences + * + * Given two strings s and t, return the number of distinct subsequences of s which equals t. + * A string's subsequence is a new string formed from the original string by deleting some (can be none) of the characters without disturbing the remaining characters' relative positions. (i.e., "ACE" is a subsequence of "ABCDE" while "AEC" is not). + * It is guaranteed the answer fits on a 32-bit signed integer. + * + * Example 1: + * + * Input: s = "rabbbit", t = "rabbit" + * Output: 3 + * Explanation: + * As shown below, there are 3 ways you can generate "rabbit" from S. + * rabbbit + * rabbbit + * rabbbit + * + * Example 2: + * + * Input: s = "babgbag", t = "bag" + * Output: 5 + * Explanation: + * As shown below, there are 5 ways you can generate "bag" from S. + * babgbag + * babgbag + * babgbag + * babgbag + * babgbag + * + * Constraints: + * + * 1 <= s.length, t.length <= 1000 + * s and t consist of English letters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/distinct-subsequences/ +// discuss: https://leetcode.com/problems/distinct-subsequences/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn num_distinct(s: String, t: String) -> i32 { + let len_s : usize = s.len(); + let len_t : usize = t.len(); + let s : Vec = s.chars().collect(); + let t : Vec = t.chars().collect(); + + let mut result : Vec> = vec![vec![0;len_t+1];len_s+1]; + result[0][0] = 1; + for i in 1..=len_s { + // empty t match once + result[i][0] = 1; + } + + for j in 1..=len_t { + // empty s match none + result[0][j] = 0; + } + + for i in 1..=len_s { + for j in 1..=len_t { + if s[i-1] == t[j-1] { + result[i][j] = result[i-1][j-1] + result[i-1][j]; + } else { + result[i][j] = result[i-1][j]; + } + } + } + + result[len_s][len_t] as i32 + } + pub fn my_num_distinct(s: String, t: String) -> i32 { + let len_s : usize = s.len(); + let len_t : usize = t.len(); + let s : Vec = s.chars().collect(); + let t : Vec = t.chars().collect(); + + let mut result : Vec> = vec![vec![0;len_t];len_s]; + let t_last_char : char = *t.last().unwrap(); + + let mut count : usize = 0; + for i in (0..len_s).rev() { + if s[i] == t_last_char { + count+=1; + } + result[i][len_t - 1] = count; + } + + for i in (0..len_s).rev() { + for j in (0..len_t-1).rev() { + if len_s - i < len_t - j {continue;} + if s[i] == t[j] { + result[i][j] = result[i+1][j+1] + result[i+1][j]; + } else { + result[i][j] = result[i+1][j]; + } + } + } + + result[0][0] as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_115() { + //assert_eq!(Solution::num_distinct("rabbbit".to_owned(), "rabbit".to_owned()), 3); + // assert_eq!( + // Solution::num_distinct("babgbag".to_owned(), "bag".to_owned()), + // 5 + // ); + // assert_eq!( + // Solution::num_distinct("aaaaaaaaaaaaaaaaaaaa".to_owned(), "aaaaaaaaaa".to_owned()), + // 184756 + // ); + } +} diff --git a/src/problem/p0120_triangle.rs b/src/problem/p0120_triangle.rs new file mode 100644 index 00000000..5492b0fe --- /dev/null +++ b/src/problem/p0120_triangle.rs @@ -0,0 +1,82 @@ +/** + * [120] Triangle + * + * Given a triangle array, return the minimum path sum from top to bottom. + * For each step, you may move to an adjacent number of the row below. More formally, if you are on index i on the current row, you may move to either index i or index i + 1 on the next row. + * + * Example 1: + * + * Input: triangle = [[2],[3,4],[6,5,7],[4,1,8,3]] + * Output: 11 + * Explanation: The triangle looks like: + * 2 + * 3 4 + * 6 5 7 + * 4 1 8 3 + * The minimum path sum from top to bottom is 2 + 3 + 5 + 1 = 11 (underlined above). + * + * Example 2: + * + * Input: triangle = [[-10]] + * Output: -10 + * + * + * Constraints: + * + * 1 <= triangle.length <= 200 + * triangle[0].length == 1 + * triangle[i].length == triangle[i - 1].length + 1 + * -10^4 <= triangle[i][j] <= 10^4 + * + * + * Follow up: Could you do this using only O(n) extra space, where n is the total number of rows in the triangle? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/triangle/ +// discuss: https://leetcode.com/problems/triangle/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn minimum_total(triangle: Vec>) -> i32 { + let mut sum = triangle.clone(); + let level_count = triangle.len(); + for i in 1..level_count { + // let prev_level_sum = &sum[i-1]; + let level = &triangle[i]; + for (j, &num) in level.iter().enumerate() { + let mut min_prev_level = 10000; + if 0 < j { + min_prev_level = std::cmp::min(min_prev_level, sum[i-1][j-1]); + } + + if sum[i-1].get(j).is_some() { + min_prev_level = std::cmp::min(min_prev_level, sum[i-1][j]); + } + sum[i][j] = min_prev_level + num; + } + } + // println!("sum: {:?}", sum); + let mut lowest_min = 10000; + for &num in sum.last().unwrap().iter() { + lowest_min = std::cmp::min(lowest_min, num); + } + lowest_min + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_120() { + assert_eq!( + Solution::minimum_total(vec![vec![2], vec![3, 4], vec![6, 5, 7], vec![4, 1, 8, 3]]), + 11 + ) + } +} diff --git a/src/problem/p0121_best_time_to_buy_and_sell_stock.rs b/src/problem/p0121_best_time_to_buy_and_sell_stock.rs new file mode 100644 index 00000000..e92c003e --- /dev/null +++ b/src/problem/p0121_best_time_to_buy_and_sell_stock.rs @@ -0,0 +1,76 @@ +/** + * [121] Best Time to Buy and Sell Stock + * + * You are given an array prices where prices[i] is the price of a given stock on the i^th day. + * You want to maximize your profit by choosing a single day to buy one stock and choosing a different day in the future to sell that stock. + * Return the maximum profit you can achieve from this transaction. If you cannot achieve any profit, return 0. + * + * Example 1: + * + * Input: prices = [7,1,5,3,6,4] + * Output: 5 + * Explanation: Buy on day 2 (price = 1) and sell on day 5 (price = 6), profit = 6-1 = 5. + * Note that buying on day 2 and selling on day 1 is not allowed because you must buy before you sell. + * + * Example 2: + * + * Input: prices = [7,6,4,3,1] + * Output: 0 + * Explanation: In this case, no transactions are done and the max profit = 0. + * + * + * Constraints: + * + * 1 <= prices.length <= 10^5 + * 0 <= prices[i] <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/best-time-to-buy-and-sell-stock/ +// discuss: https://leetcode.com/problems/best-time-to-buy-and-sell-stock/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn max_profit(prices: Vec) -> i32 { + let mut last_no_stock_balance = 0i32; + let mut last_with_stock_balance = -2_147_483_648i32; + for &price in prices.iter() { + last_no_stock_balance = std::cmp::max(last_no_stock_balance, last_with_stock_balance + price); + + last_with_stock_balance = std::cmp::max(last_with_stock_balance, 0 - price); + } + last_no_stock_balance + } + + pub fn max_profit1(prices: Vec) -> i32 { + // kadane's alg on consecutive diff. + let mut max_so_far = 0; + let mut cur_max = 0; + for i in 1..prices.len() { + if cur_max < 0 { + cur_max = prices[i] - prices[i-1]; + } else { + cur_max += prices[i] - prices[i-1]; + } + if max_so_far < cur_max { + max_so_far = cur_max; + } + } + max_so_far + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_121() { + assert_eq!(Solution::max_profit(vec![7, 1, 5, 3, 6, 4]), 5); + assert_eq!(Solution::max_profit(vec![7, 6, 4, 3, 1]), 0); + } +} diff --git a/src/problem/p0122_best_time_to_buy_and_sell_stock_ii.rs b/src/problem/p0122_best_time_to_buy_and_sell_stock_ii.rs new file mode 100644 index 00000000..186fcd73 --- /dev/null +++ b/src/problem/p0122_best_time_to_buy_and_sell_stock_ii.rs @@ -0,0 +1,122 @@ +/** + * [122] Best Time to Buy and Sell Stock II + * + * You are given an array prices where prices[i] is the price of a given stock on the i^th day. + * Find the maximum profit you can achieve. You may complete as many transactions as you like (i.e., buy one and sell one share of the stock multiple times). + * Note: You may not engage in multiple transactions simultaneously (i.e., you must sell the stock before you buy again). + * + * Example 1: + * + * Input: prices = [7,1,5,3,6,4] + * Output: 7 + * Explanation: Buy on day 2 (price = 1) and sell on day 3 (price = 5), profit = 5-1 = 4. + * Then buy on day 4 (price = 3) and sell on day 5 (price = 6), profit = 6-3 = 3. + * + * Example 2: + * + * Input: prices = [1,2,3,4,5] + * Output: 4 + * Explanation: Buy on day 1 (price = 1) and sell on day 5 (price = 5), profit = 5-1 = 4. + * Note that you cannot buy on day 1, buy on day 2 and sell them later, as you are engaging multiple transactions at the same time. You must sell before buying again. + * + * Example 3: + * + * Input: prices = [7,6,4,3,1] + * Output: 0 + * Explanation: In this case, no transaction is done, i.e., max profit = 0. + * + * + * Constraints: + * + * 1 <= prices.length <= 3 * 10^4 + * 0 <= prices[i] <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/best-time-to-buy-and-sell-stock-ii/ +// discuss: https://leetcode.com/problems/best-time-to-buy-and-sell-stock-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn max_profit(prices: Vec) -> i32 { + let mut last_no_stock_balance : i32 = 0; + let mut last_with_stock_balance : i32 = -2_147_483_648i32; + + for price in prices.iter() { + let last_no_stock_balance_cache = last_no_stock_balance; + last_no_stock_balance = std::cmp::max(last_no_stock_balance, last_with_stock_balance + price); + + last_with_stock_balance = std::cmp::max(last_with_stock_balance, last_no_stock_balance_cache - price) + } + last_no_stock_balance + } + + pub fn max_profit1(prices: Vec) -> i32 { + let n : usize = prices.len(); + if n == 0 || n == 1 {return 0;} + let mut local_mins : Vec = vec![]; + let mut local_maxs : Vec = vec![]; + + let is_local_min = |i|{ + if i==0 { + prices[i] <= prices[i+1] + } else if i == n-1 { + false + } else { + prices[i-1] >= prices[i] && prices[i] <= prices[i+1] + } + }; + + let is_local_max = |i|{ + if i==0 { + false + } else if i == n-1 { + prices[i-1] <= prices[i] + } else { + prices[i-1] <= prices[i] && prices[i] >= prices[i+1] + } + }; + let mut i : usize = 0; + loop { + let mut cur_local_min : i32 = 0; + let mut cur_local_max : i32 = 0; + while i < n && !is_local_min(i) { + i+=1; + } + if i == n { break;} + cur_local_min = prices[i]; + + i+=1; + while i < n && !is_local_max(i) { + i+=1; + } + if i == n { break;} + cur_local_max = prices[i]; + + local_mins.push(cur_local_min); + local_maxs.push(cur_local_max); + } + // println!("local_mins={:?}, local_maxs={:?}", local_mins, local_maxs); + let mut sum : i32 = 0; + for i in 0..local_maxs.len() { + sum += local_maxs[i] - local_mins[i]; + } + sum + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_122() { + assert_eq!(Solution::max_profit(vec![7, 1, 5, 3, 6, 4]), 7); + assert_eq!(Solution::max_profit(vec![1, 2, 3, 4, 5]), 4); + assert_eq!(Solution::max_profit(vec![2, 2, 5]), 3); + } +} diff --git a/src/problem/p0123_best_time_to_buy_and_sell_stock_iii.rs b/src/problem/p0123_best_time_to_buy_and_sell_stock_iii.rs new file mode 100644 index 00000000..384b4966 --- /dev/null +++ b/src/problem/p0123_best_time_to_buy_and_sell_stock_iii.rs @@ -0,0 +1,71 @@ +/** + * [123] Best Time to Buy and Sell Stock III + * + * You are given an array prices where prices[i] is the price of a given stock on the i^th day. + * Find the maximum profit you can achieve. You may complete at most two transactions. + * Note: You may not engage in multiple transactions simultaneously (i.e., you must sell the stock before you buy again). + * + * Example 1: + * + * Input: prices = [3,3,5,0,0,3,1,4] + * Output: 6 + * Explanation: Buy on day 4 (price = 0) and sell on day 6 (price = 3), profit = 3-0 = 3. + * Then buy on day 7 (price = 1) and sell on day 8 (price = 4), profit = 4-1 = 3. + * Example 2: + * + * Input: prices = [1,2,3,4,5] + * Output: 4 + * Explanation: Buy on day 1 (price = 1) and sell on day 5 (price = 5), profit = 5-1 = 4. + * Note that you cannot buy on day 1, buy on day 2 and sell them later, as you are engaging multiple transactions at the same time. You must sell before buying again. + * + * Example 3: + * + * Input: prices = [7,6,4,3,1] + * Output: 0 + * Explanation: In this case, no transaction is done, i.e. max profit = 0. + * + * Example 4: + * + * Input: prices = [1] + * Output: 0 + * + * + * Constraints: + * + * 1 <= prices.length <= 10^5 + * 0 <= prices[i] <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/best-time-to-buy-and-sell-stock-iii/ +// discuss: https://leetcode.com/problems/best-time-to-buy-and-sell-stock-iii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn max_profit(prices: Vec) -> i32 { + let n = prices.len(); + let mut balances : Vec> = vec![vec![0;n];3]; + for k in 1..=2 { + let mut min = prices[0]; + for i in 1..n { + min = std::cmp::min(min, prices[i]-balances[k-1][i-1]); + balances[k][i] = std::cmp::max(balances[k][i-1], prices[i] - min); + } + } + balances[2][n-1] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_123() { + assert_eq!(Solution::max_profit(vec![3, 3, 5, 0, 0, 3, 1, 4]), 6); + } +} diff --git a/src/problem/p0124_binary_tree_maximum_path_sum.rs b/src/problem/p0124_binary_tree_maximum_path_sum.rs new file mode 100644 index 00000000..c5fe2b2b --- /dev/null +++ b/src/problem/p0124_binary_tree_maximum_path_sum.rs @@ -0,0 +1,93 @@ +/** + * [124] Binary Tree Maximum Path Sum + * + * A path in a binary tree is a sequence of nodes where each pair of adjacent nodes in the sequence has an edge connecting them. A node can only appear in the sequence at most once. Note that the path does not need to pass through the root. + * The path sum of a path is the sum of the node's values in the path. + * Given the root of a binary tree, return the maximum path sum of any path. + * + * Example 1: + * + * Input: root = [1,2,3] + * Output: 6 + * Explanation: The optimal path is 2 -> 1 -> 3 with a path sum of 2 + 1 + 3 = 6. + * + * Example 2: + * + * Input: root = [-10,9,20,null,null,15,7] + * Output: 42 + * Explanation: The optimal path is 15 -> 20 -> 7 with a path sum of 15 + 20 + 7 = 42. + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [1, 3 * 10^4]. + * -1000 <= Node.val <= 1000 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/binary-tree-maximum-path-sum/ +// discuss: https://leetcode.com/problems/binary-tree-maximum-path-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn traverse(node: &Option>>, cur_max : &mut i32) -> i32 { + if node.is_none() { return 0; } + let node_val : i32 = node.as_ref().unwrap().borrow().val; + let left_max : i32 = Self::traverse(&node.as_ref().unwrap().borrow().left, cur_max); + let right_max : i32 = Self::traverse(&node.as_ref().unwrap().borrow().right, cur_max); + + // conditioned that the path must include this node. + *cur_max = std::cmp::max(*cur_max, node_val + left_max + right_max); + *[0, node_val, left_max + node_val, right_max + node_val].iter().max().unwrap() + + } + pub fn max_path_sum(root: Option>>) -> i32 { + let mut max = - 1 << 30; + Self::traverse(&root, &mut max); + max + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_124() { + assert_eq!(Solution::max_path_sum(tree![1, 2, 3]), 6); + assert_eq!( + Solution::max_path_sum(tree![-10, 9, 20, null, null, 15, 7]), + 42 + ); + assert_eq!( + Solution::max_path_sum(tree![5, 4, 8, 11, null, 13, 4, 7, 2, null, null, null, 1]), + 48 + ); + assert_eq!(Solution::max_path_sum(tree![-3]), -3); + } +} diff --git a/src/problem/p0126_word_ladder_ii.rs b/src/problem/p0126_word_ladder_ii.rs new file mode 100644 index 00000000..f065f35e --- /dev/null +++ b/src/problem/p0126_word_ladder_ii.rs @@ -0,0 +1,189 @@ + +/** + * [126] Word Ladder II + * + * A transformation sequence from word beginWord to word endWord using a dictionary wordList is a sequence of words beginWord -> s1 -> s2 -> ... -> sk such that: + * + * Every adjacent pair of words differs by a single letter. + * Every si for 1 <= i <= k is in wordList. Note that beginWord does not need to be in wordList. + * sk == endWord + * + * Given two words, beginWord and endWord, and a dictionary wordList, return all the shortest transformation sequences from beginWord to endWord, or an empty list if no such sequence exists. Each sequence should be returned as a list of the words [beginWord, s1, s2, ..., sk]. + * + * Example 1: + * + * Input: beginWord = "hit", endWord = "cog", wordList = ["hot","dot","dog","lot","log","cog"] + * Output: [["hit","hot","dot","dog","cog"],["hit","hot","lot","log","cog"]] + * Explanation: There are 2 shortest transformation sequences: + * "hit" -> "hot" -> "dot" -> "dog" -> "cog" + * "hit" -> "hot" -> "lot" -> "log" -> "cog" + * + * Example 2: + * + * Input: beginWord = "hit", endWord = "cog", wordList = ["hot","dot","dog","lot","log"] + * Output: [] + * Explanation: The endWord "cog" is not in wordList, therefore there is no valid transformation sequence. + * + * + * Constraints: + * + * 1 <= beginWord.length <= 10 + * endWord.length == beginWord.length + * 1 <= wordList.length <= 5000 + * wordList[i].length == beginWord.length + * beginWord, endWord, and wordList[i] consist of lowercase English letters. + * beginWord != endWord + * All the words in wordList are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/word-ladder-ii/ +// discuss: https://leetcode.com/problems/word-ladder-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// The current traversed path in vector, +// The index of the flipped char in map. +use std::collections::HashSet; +use std::collections::{HashMap, VecDeque}; +// TODO:timeout +impl Solution { + pub fn find_ladders(begin_word: String, end_word: String, word_list: Vec) -> Vec> { + + let mut unvisited : HashSet = word_list.clone().into_iter().collect(); + let mut visited_queue : VecDeque> = VecDeque::new(); + visited_queue.push_back(vec![begin_word.clone()]); + let mut min_level : Option = None; + let mut results = vec![]; + while let Some(cur_path) = visited_queue.pop_front() { + let cur_level = cur_path.len(); + let last_word = cur_path.last().unwrap().clone(); + unvisited.remove(&last_word); + // println!("cur_level={},last_word={},min_level={:?}, visited_queue.len={}", cur_level, last_word, min_level, visited_queue.len()); + if min_level.is_some() && cur_level > min_level.unwrap() { + return results; + } + if last_word == end_word { + results.push(cur_path); + min_level = Some(cur_level); + } else { + for i in 0..last_word.len() { + // for &new_char in chars_at_idx[i].iter() { + for c in 0..26 { + let new_char : char = ('a' as u8 + c as u8) as char; + let mut word_chars : Vec = last_word.chars().collect(); + word_chars[i] = new_char; + let new_word : String = word_chars.iter().collect(); + if unvisited.contains(&new_word) { + // if word_list.contains(&new_word) && cur_path.iter().all(|word|{!word.eq(&new_word)}) { + + let mut new_path = cur_path.clone(); + new_path.push(new_word); + visited_queue.push_back(new_path); + } + } + } + + } + + } + results + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_126() { + assert_eq!( + Solution::find_ladders( + "hit".to_owned(), + "cog".to_owned(), + vec_string!["hot", "dot", "dog", "lot", "log", "cog"] + ), + vec![ + vec_string!["hit", "hot", "dot", "dog", "cog"], + vec_string!["hit", "hot", "lot", "log", "cog"], + ] + ); + assert_eq!( + Solution::find_ladders( + "cet".to_owned(), + "ism".to_owned(), + vec_string![ + "kid", "tag", "pup", "ail", "tun", "woo", "erg", "luz", "brr", "gay", "sip", + "kay", "per", "val", "mes", "ohs", "now", "boa", "cet", "pal", "bar", "die", + "war", "hay", "eco", "pub", "lob", "rue", "fry", "lit", "rex", "jan", "cot", + "bid", "ali", "pay", "col", "gum", "ger", "row", "won", "dan", "rum", "fad", + "tut", "sag", "yip", "sui", "ark", "has", "zip", "fez", "own", "ump", "dis", + "ads", "max", "jaw", "out", "btu", "ana", "gap", "cry", "led", "abe", "box", + "ore", "pig", "fie", "toy", "fat", "cal", "lie", "noh", "sew", "ono", "tam", + "flu", "mgm", "ply", "awe", "pry", "tit", "tie", "yet", "too", "tax", "jim", + "san", "pan", "map", "ski", "ova", "wed", "non", "wac", "nut", "why", "bye", + "lye", "oct", "old", "fin", "feb", "chi", "sap", "owl", "log", "tod", "dot", + "bow", "fob", "for", "joe", "ivy", "fan", "age", "fax", "hip", "jib", "mel", + "hus", "sob", "ifs", "tab", "ara", "dab", "jag", "jar", "arm", "lot", "tom", + "sax", "tex", "yum", "pei", "wen", "wry", "ire", "irk", "far", "mew", "wit", + "doe", "gas", "rte", "ian", "pot", "ask", "wag", "hag", "amy", "nag", "ron", + "soy", "gin", "don", "tug", "fay", "vic", "boo", "nam", "ave", "buy", "sop", + "but", "orb", "fen", "paw", "his", "sub", "bob", "yea", "oft", "inn", "rod", + "yam", "pew", "web", "hod", "hun", "gyp", "wei", "wis", "rob", "gad", "pie", + "mon", "dog", "bib", "rub", "ere", "dig", "era", "cat", "fox", "bee", "mod", + "day", "apr", "vie", "nev", "jam", "pam", "new", "aye", "ani", "and", "ibm", + "yap", "can", "pyx", "tar", "kin", "fog", "hum", "pip", "cup", "dye", "lyx", + "jog", "nun", "par", "wan", "fey", "bus", "oak", "bad", "ats", "set", "qom", + "vat", "eat", "pus", "rev", "axe", "ion", "six", "ila", "lao", "mom", "mas", + "pro", "few", "opt", "poe", "art", "ash", "oar", "cap", "lop", "may", "shy", + "rid", "bat", "sum", "rim", "fee", "bmw", "sky", "maj", "hue", "thy", "ava", + "rap", "den", "fla", "auk", "cox", "ibo", "hey", "saw", "vim", "sec", "ltd", + "you", "its", "tat", "dew", "eva", "tog", "ram", "let", "see", "zit", "maw", + "nix", "ate", "gig", "rep", "owe", "ind", "hog", "eve", "sam", "zoo", "any", + "dow", "cod", "bed", "vet", "ham", "sis", "hex", "via", "fir", "nod", "mao", + "aug", "mum", "hoe", "bah", "hal", "keg", "hew", "zed", "tow", "gog", "ass", + "dem", "who", "bet", "gos", "son", "ear", "spy", "kit", "boy", "due", "sen", + "oaf", "mix", "hep", "fur", "ada", "bin", "nil", "mia", "ewe", "hit", "fix", + "sad", "rib", "eye", "hop", "haw", "wax", "mid", "tad", "ken", "wad", "rye", + "pap", "bog", "gut", "ito", "woe", "our", "ado", "sin", "mad", "ray", "hon", + "roy", "dip", "hen", "iva", "lug", "asp", "hui", "yak", "bay", "poi", "yep", + "bun", "try", "lad", "elm", "nat", "wyo", "gym", "dug", "toe", "dee", "wig", + "sly", "rip", "geo", "cog", "pas", "zen", "odd", "nan", "lay", "pod", "fit", + "hem", "joy", "bum", "rio", "yon", "dec", "leg", "put", "sue", "dim", "pet", + "yaw", "nub", "bit", "bur", "sid", "sun", "oil", "red", "doc", "moe", "caw", + "eel", "dix", "cub", "end", "gem", "off", "yew", "hug", "pop", "tub", "sgt", + "lid", "pun", "ton", "sol", "din", "yup", "jab", "pea", "bug", "gag", "mil", + "jig", "hub", "low", "did", "tin", "get", "gte", "sox", "lei", "mig", "fig", + "lon", "use", "ban", "flo", "nov", "jut", "bag", "mir", "sty", "lap", "two", + "ins", "con", "ant", "net", "tux", "ode", "stu", "mug", "cad", "nap", "gun", + "fop", "tot", "sow", "sal", "sic", "ted", "wot", "del", "imp", "cob", "way", + "ann", "tan", "mci", "job", "wet", "ism", "err", "him", "all", "pad", "hah", + "hie", "aim", "ike", "jed", "ego", "mac", "baa", "min", "com", "ill", "was", + "cab", "ago", "ina", "big", "ilk", "gal", "tap", "duh", "ola", "ran", "lab", + "top", "gob", "hot", "ora", "tia", "kip", "han", "met", "hut", "she", "sac", + "fed", "goo", "tee", "ell", "not", "act", "gil", "rut", "ala", "ape", "rig", + "cid", "god", "duo", "lin", "aid", "gel", "awl", "lag", "elf", "liz", "ref", + "aha", "fib", "oho", "tho", "her", "nor", "ace", "adz", "fun", "ned", "coo", + "win", "tao", "coy", "van", "man", "pit", "guy", "foe", "hid", "mai", "sup", + "jay", "hob", "mow", "jot", "are", "pol", "arc", "lax", "aft", "alb", "len", + "air", "pug", "pox", "vow", "got", "meg", "zoe", "amp", "ale", "bud", "gee", + "pin", "dun", "pat", "ten", "mob" + ] + ), + vec![ + vec_string![ + "cet", "get", "gee", "gte", "ate", "ats", "its", "ito", "ibo", "ibm", "ism" + ], + vec_string![ + "cet", "cat", "can", "ian", "inn", "ins", "its", "ito", "ibo", "ibm", "ism" + ], + vec_string![ + "cet", "cot", "con", "ion", "inn", "ins", "its", "ito", "ibo", "ibm", "ism" + ], + ] + ); + } +} diff --git a/src/problem/p0127_word_ladder.rs b/src/problem/p0127_word_ladder.rs new file mode 100644 index 00000000..cac04d70 --- /dev/null +++ b/src/problem/p0127_word_ladder.rs @@ -0,0 +1,112 @@ +/** + * [127] Word Ladder + * + * A transformation sequence from word beginWord to word endWord using a dictionary wordList is a sequence of words beginWord -> s1 -> s2 -> ... -> sk such that: + * + * Every adjacent pair of words differs by a single letter. + * Every si for 1 <= i <= k is in wordList. Note that beginWord does not need to be in wordList. + * sk == endWord + * + * Given two words, beginWord and endWord, and a dictionary wordList, return the number of words in the shortest transformation sequence from beginWord to endWord, or 0 if no such sequence exists. + * + * Example 1: + * + * Input: beginWord = "hit", endWord = "cog", wordList = ["hot","dot","dog","lot","log","cog"] + * Output: 5 + * Explanation: One shortest transformation sequence is "hit" -> "hot" -> "dot" -> "dog" -> cog", which is 5 words long. + * + * Example 2: + * + * Input: beginWord = "hit", endWord = "cog", wordList = ["hot","dot","dog","lot","log"] + * Output: 0 + * Explanation: The endWord "cog" is not in wordList, therefore there is no valid transformation sequence. + * + * + * Constraints: + * + * 1 <= beginWord.length <= 10 + * endWord.length == beginWord.length + * 1 <= wordList.length <= 5000 + * wordList[i].length == beginWord.length + * beginWord, endWord, and wordList[i] consist of lowercase English letters. + * beginWord != endWord + * All the words in wordList are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/word-ladder/ +// discuss: https://leetcode.com/problems/word-ladder/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashSet; +use std::collections::VecDeque; +impl Solution { + pub fn ladder_length(begin_word: String, end_word: String, word_list: Vec) -> i32 { + + let mut unvisited : HashSet = word_list.clone().into_iter().collect(); + let mut visited_queue : VecDeque<(String, usize)> = VecDeque::new(); + visited_queue.push_back((begin_word.clone(),1)); + + while let Some(cur_entry) = visited_queue.pop_front() { + let cur_word : String = cur_entry.0; + + let cur_level : usize = cur_entry.1; + // println!("cur_word={}, cur_level={}, unvisited.len()={}", cur_word, cur_level, unvisited.len()); + if cur_word == end_word { + return cur_level as i32; + } + for i in 0..cur_word.len() { + // for &new_char in chars_at_idx[i].iter() { + for c in 0..26 { + let new_char : char = ('a' as u8 + c as u8) as char; + let mut word_chars : Vec = cur_word.chars().collect(); + word_chars[i] = new_char; + let new_word : String = word_chars.iter().collect(); + if unvisited.contains(&new_word) { + unvisited.remove(&new_word); + visited_queue.push_back((new_word, cur_level+1)); + } + } + } + } + + 0 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_127() { + // assert_eq!( + // Solution::ladder_length( + // "hit".to_owned(), + // "cog".to_owned(), + // vec_string!["hot", "dot", "dog", "lot", "log", "cog"] + // ), + // 5 + // ); + // assert_eq!( + // Solution::ladder_length( + // "hit".to_owned(), + // "cog".to_owned(), + // vec_string!["hot", "dot", "dog", "lot", "log"] + // ), + // 0 + // ); + + assert_eq!( + Solution::ladder_length( + "sand".to_owned(), + "acne".to_owned(), + vec_string!["slit","bunk","wars","ping","viva","wynn","wows","irks","gang","pool","mock","fort","heel","send","ship","cols","alec","foal","nabs","gaze","giza","mays","dogs","karo","cums","jedi","webb","lend","mire","jose","catt","grow","toss","magi","leis","bead","kara","hoof","than","ires","baas","vein","kari","riga","oars","gags","thug","yawn","wive","view","germ","flab","july","tuck","rory","bean","feed","rhee","jeez","gobs","lath","desk","yoko","cute","zeus","thus","dims","link","dirt","mara","disc","limy","lewd","maud","duly","elsa","hart","rays","rues","camp","lack","okra","tome","math","plug","monk","orly","friz","hogs","yoda","poop","tick","plod","cloy","pees","imps","lead","pope","mall","frey","been","plea","poll","male","teak","soho","glob","bell","mary","hail","scan","yips","like","mull","kory","odor","byte","kaye","word","honk","asks","slid","hopi","toke","gore","flew","tins","mown","oise","hall","vega","sing","fool","boat","bobs","lain","soft","hard","rots","sees","apex","chan","told","woos","unit","scow","gilt","beef","jars","tyre","imus","neon","soap","dabs","rein","ovid","hose","husk","loll","asia","cope","tail","hazy","clad","lash","sags","moll","eddy","fuel","lift","flog","land","sigh","saks","sail","hook","visa","tier","maws","roeg","gila","eyes","noah","hypo","tore","eggs","rove","chap","room","wait","lurk","race","host","dada","lola","gabs","sobs","joel","keck","axed","mead","gust","laid","ends","oort","nose","peer","kept","abet","iran","mick","dead","hags","tens","gown","sick","odis","miro","bill","fawn","sumo","kilt","huge","ores","oran","flag","tost","seth","sift","poet","reds","pips","cape","togo","wale","limn","toll","ploy","inns","snag","hoes","jerk","flux","fido","zane","arab","gamy","raze","lank","hurt","rail","hind","hoot","dogy","away","pest","hoed","pose","lose","pole","alva","dino","kind","clan","dips","soup","veto","edna","damp","gush","amen","wits","pubs","fuzz","cash","pine","trod","gunk","nude","lost","rite","cory","walt","mica","cart","avow","wind","book","leon","life","bang","draw","leek","skis","dram","ripe","mine","urea","tiff","over","gale","weir","defy","norm","tull","whiz","gill","ward","crag","when","mill","firs","sans","flue","reid","ekes","jain","mutt","hems","laps","piss","pall","rowe","prey","cull","knew","size","wets","hurl","wont","suva","girt","prys","prow","warn","naps","gong","thru","livy","boar","sade","amok","vice","slat","emir","jade","karl","loyd","cerf","bess","loss","rums","lats","bode","subs","muss","maim","kits","thin","york","punt","gays","alpo","aids","drag","eras","mats","pyre","clot","step","oath","lout","wary","carp","hums","tang","pout","whip","fled","omar","such","kano","jake","stan","loop","fuss","mini","byrd","exit","fizz","lire","emil","prop","noes","awed","gift","soli","sale","gage","orin","slur","limp","saar","arks","mast","gnat","port","into","geed","pave","awls","cent","cunt","full","dint","hank","mate","coin","tars","scud","veer","coax","bops","uris","loom","shod","crib","lids","drys","fish","edit","dick","erna","else","hahs","alga","moho","wire","fora","tums","ruth","bets","duns","mold","mush","swop","ruby","bolt","nave","kite","ahem","brad","tern","nips","whew","bait","ooze","gino","yuck","drum","shoe","lobe","dusk","cult","paws","anew","dado","nook","half","lams","rich","cato","java","kemp","vain","fees","sham","auks","gish","fire","elam","salt","sour","loth","whit","yogi","shes","scam","yous","lucy","inez","geld","whig","thee","kelp","loaf","harm","tomb","ever","airs","page","laud","stun","paid","goop","cobs","judy","grab","doha","crew","item","fogs","tong","blip","vest","bran","wend","bawl","feel","jets","mixt","tell","dire","devi","milo","deng","yews","weak","mark","doug","fare","rigs","poke","hies","sian","suez","quip","kens","lass","zips","elva","brat","cosy","teri","hull","spun","russ","pupa","weed","pulp","main","grim","hone","cord","barf","olav","gaps","rote","wilt","lars","roll","balm","jana","give","eire","faun","suck","kegs","nita","weer","tush","spry","loge","nays","heir","dope","roar","peep","nags","ates","bane","seas","sign","fred","they","lien","kiev","fops","said","lawn","lind","miff","mass","trig","sins","furl","ruin","sent","cray","maya","clog","puns","silk","axis","grog","jots","dyer","mope","rand","vend","keen","chou","dose","rain","eats","sped","maui","evan","time","todd","skit","lief","sops","outs","moot","faze","biro","gook","fill","oval","skew","veil","born","slob","hyde","twin","eloy","beat","ergs","sure","kobe","eggo","hens","jive","flax","mons","dunk","yest","begs","dial","lodz","burp","pile","much","dock","rene","sago","racy","have","yalu","glow","move","peps","hods","kins","salk","hand","cons","dare","myra","sega","type","mari","pelt","hula","gulf","jugs","flay","fest","spat","toms","zeno","taps","deny","swag","afro","baud","jabs","smut","egos","lara","toes","song","fray","luis","brut","olen","mere","ruff","slum","glad","buds","silt","rued","gelt","hive","teem","ides","sink","ands","wisp","omen","lyre","yuks","curb","loam","darn","liar","pugs","pane","carl","sang","scar","zeds","claw","berg","hits","mile","lite","khan","erik","slug","loon","dena","ruse","talk","tusk","gaol","tads","beds","sock","howe","gave","snob","ahab","part","meir","jell","stir","tels","spit","hash","omit","jinx","lyra","puck","laue","beep","eros","owed","cede","brew","slue","mitt","jest","lynx","wads","gena","dank","volt","gray","pony","veld","bask","fens","argo","work","taxi","afar","boon","lube","pass","lazy","mist","blot","mach","poky","rams","sits","rend","dome","pray","duck","hers","lure","keep","gory","chat","runt","jams","lays","posy","bats","hoff","rock","keri","raul","yves","lama","ramp","vote","jody","pock","gist","sass","iago","coos","rank","lowe","vows","koch","taco","jinn","juno","rape","band","aces","goal","huck","lila","tuft","swan","blab","leda","gems","hide","tack","porn","scum","frat","plum","duds","shad","arms","pare","chin","gain","knee","foot","line","dove","vera","jays","fund","reno","skid","boys","corn","gwyn","sash","weld","ruiz","dior","jess","leaf","pars","cote","zing","scat","nice","dart","only","owls","hike","trey","whys","ding","klan","ross","barb","ants","lean","dopy","hock","tour","grip","aldo","whim","prom","rear","dins","duff","dell","loch","lava","sung","yank","thar","curl","venn","blow","pomp","heat","trap","dali","nets","seen","gash","twig","dads","emmy","rhea","navy","haws","mite","bows","alas","ives","play","soon","doll","chum","ajar","foam","call","puke","kris","wily","came","ales","reef","raid","diet","prod","prut","loot","soar","coed","celt","seam","dray","lump","jags","nods","sole","kink","peso","howl","cost","tsar","uric","sore","woes","sewn","sake","cask","caps","burl","tame","bulk","neva","from","meet","webs","spar","fuck","buoy","wept","west","dual","pica","sold","seed","gads","riff","neck","deed","rudy","drop","vale","flit","romp","peak","jape","jews","fain","dens","hugo","elba","mink","town","clam","feud","fern","dung","newt","mime","deem","inti","gigs","sosa","lope","lard","cara","smug","lego","flex","doth","paar","moon","wren","tale","kant","eels","muck","toga","zens","lops","duet","coil","gall","teal","glib","muir","ails","boer","them","rake","conn","neat","frog","trip","coma","must","mono","lira","craw","sled","wear","toby","reel","hips","nate","pump","mont","died","moss","lair","jibe","oils","pied","hobs","cads","haze","muse","cogs","figs","cues","roes","whet","boru","cozy","amos","tans","news","hake","cots","boas","tutu","wavy","pipe","typo","albs","boom","dyke","wail","woke","ware","rita","fail","slab","owes","jane","rack","hell","lags","mend","mask","hume","wane","acne","team","holy","runs","exes","dole","trim","zola","trek","puma","wacs","veep","yaps","sums","lush","tubs","most","witt","bong","rule","hear","awry","sots","nils","bash","gasp","inch","pens","fies","juts","pate","vine","zulu","this","bare","veal","josh","reek","ours","cowl","club","farm","teat","coat","dish","fore","weft","exam","vlad","floe","beak","lane","ella","warp","goth","ming","pits","rent","tito","wish","amps","says","hawk","ways","punk","nark","cagy","east","paul","bose","solo","teed","text","hews","snip","lips","emit","orgy","icon","tuna","soul","kurd","clod","calk","aunt","bake","copy","acid","duse","kiln","spec","fans","bani","irma","pads","batu","logo","pack","oder","atop","funk","gide","bede","bibs","taut","guns","dana","puff","lyme","flat","lake","june","sets","gull","hops","earn","clip","fell","kama","seal","diaz","cite","chew","cuba","bury","yard","bank","byes","apia","cree","nosh","judo","walk","tape","taro","boot","cods","lade","cong","deft","slim","jeri","rile","park","aeon","fact","slow","goff","cane","earp","tart","does","acts","hope","cant","buts","shin","dude","ergo","mode","gene","lept","chen","beta","eden","pang","saab","fang","whir","cove","perk","fads","rugs","herb","putt","nous","vane","corm","stay","bids","vela","roof","isms","sics","gone","swum","wiry","cram","rink","pert","heap","sikh","dais","cell","peel","nuke","buss","rasp","none","slut","bent","dams","serb","dork","bays","kale","cora","wake","welt","rind","trot","sloe","pity","rout","eves","fats","furs","pogo","beth","hued","edam","iamb","glee","lute","keel","airy","easy","tire","rube","bogy","sine","chop","rood","elbe","mike","garb","jill","gaul","chit","dons","bars","ride","beck","toad","make","head","suds","pike","snot","swat","peed","same","gaza","lent","gait","gael","elks","hang","nerf","rosy","shut","glop","pain","dion","deaf","hero","doer","wost","wage","wash","pats","narc","ions","dice","quay","vied","eons","case","pour","urns","reva","rags","aden","bone","rang","aura","iraq","toot","rome","hals","megs","pond","john","yeps","pawl","warm","bird","tint","jowl","gibe","come","hold","pail","wipe","bike","rips","eery","kent","hims","inks","fink","mott","ices","macy","serf","keys","tarp","cops","sods","feet","tear","benz","buys","colo","boil","sews","enos","watt","pull","brag","cork","save","mint","feat","jamb","rubs","roxy","toys","nosy","yowl","tamp","lobs","foul","doom","sown","pigs","hemp","fame","boor","cube","tops","loco","lads","eyre","alta","aged","flop","pram","lesa","sawn","plow","aral","load","lied","pled","boob","bert","rows","zits","rick","hint","dido","fist","marc","wuss","node","smog","nora","shim","glut","bale","perl","what","tort","meek","brie","bind","cake","psst","dour","jove","tree","chip","stud","thou","mobs","sows","opts","diva","perm","wise","cuds","sols","alan","mild","pure","gail","wins","offs","nile","yelp","minn","tors","tran","homy","sadr","erse","nero","scab","finn","mich","turd","then","poem","noun","oxus","brow","door","saws","eben","wart","wand","rosa","left","lina","cabs","rapt","olin","suet","kalb","mans","dawn","riel","temp","chug","peal","drew","null","hath","many","took","fond","gate","sate","leak","zany","vans","mart","hess","home","long","dirk","bile","lace","moog","axes","zone","fork","duct","rico","rife","deep","tiny","hugh","bilk","waft","swig","pans","with","kern","busy","film","lulu","king","lord","veda","tray","legs","soot","ells","wasp","hunt","earl","ouch","diem","yell","pegs","blvd","polk","soda","zorn","liza","slop","week","kill","rusk","eric","sump","haul","rims","crop","blob","face","bins","read","care","pele","ritz","beau","golf","drip","dike","stab","jibs","hove","junk","hoax","tats","fief","quad","peat","ream","hats","root","flak","grit","clap","pugh","bosh","lock","mute","crow","iced","lisa","bela","fems","oxes","vies","gybe","huff","bull","cuss","sunk","pups","fobs","turf","sect","atom","debt","sane","writ","anon","mayo","aria","seer","thor","brim","gawk","jack","jazz","menu","yolk","surf","libs","lets","bans","toil","open","aced","poor","mess","wham","fran","gina","dote","love","mood","pale","reps","ines","shot","alar","twit","site","dill","yoga","sear","vamp","abel","lieu","cuff","orbs","rose","tank","gape","guam","adar","vole","your","dean","dear","hebe","crab","hump","mole","vase","rode","dash","sera","balk","lela","inca","gaea","bush","loud","pies","aide","blew","mien","side","kerr","ring","tess","prep","rant","lugs","hobo","joke","odds","yule","aida","true","pone","lode","nona","weep","coda","elmo","skim","wink","bras","pier","bung","pets","tabs","ryan","jock","body","sofa","joey","zion","mace","kick","vile","leno","bali","fart","that","redo","ills","jogs","pent","drub","slaw","tide","lena","seep","gyps","wave","amid","fear","ties","flan","wimp","kali","shun","crap","sage","rune","logs","cain","digs","abut","obit","paps","rids","fair","hack","huns","road","caws","curt","jute","fisk","fowl","duty","holt","miss","rude","vito","baal","ural","mann","mind","belt","clem","last","musk","roam","abed","days","bore","fuze","fall","pict","dump","dies","fiat","vent","pork","eyed","docs","rive","spas","rope","ariz","tout","game","jump","blur","anti","lisp","turn","sand","food","moos","hoop","saul","arch","fury","rise","diss","hubs","burs","grid","ilks","suns","flea","soil","lung","want","nola","fins","thud","kidd","juan","heps","nape","rash","burt","bump","tots","brit","mums","bole","shah","tees","skip","limb","umps","ache","arcs","raft","halo","luce","bahs","leta","conk","duos","siva","went","peek","sulk","reap","free","dubs","lang","toto","hasp","ball","rats","nair","myst","wang","snug","nash","laos","ante","opal","tina","pore","bite","haas","myth","yugo","foci","dent","bade","pear","mods","auto","shop","etch","lyly","curs","aron","slew","tyro","sack","wade","clio","gyro","butt","icky","char","itch","halt","gals","yang","tend","pact","bees","suit","puny","hows","nina","brno","oops","lick","sons","kilo","bust","nome","mona","dull","join","hour","papa","stag","bern","wove","lull","slip","laze","roil","alto","bath","buck","alma","anus","evil","dumb","oreo","rare","near","cure","isis","hill","kyle","pace","comb","nits","flip","clop","mort","thea","wall","kiel","judd","coop","dave","very","amie","blah","flub","talc","bold","fogy","idea","prof","horn","shoo","aped","pins","helm","wees","beer","womb","clue","alba","aloe","fine","bard","limo","shaw","pint","swim","dust","indy","hale","cats","troy","wens","luke","vern","deli","both","brig","daub","sara","sued","bier","noel","olga","dupe","look","pisa","knox","murk","dame","matt","gold","jame","toge","luck","peck","tass","calf","pill","wore","wadi","thur","parr","maul","tzar","ones","lees","dark","fake","bast","zoom","here","moro","wine","bums","cows","jean","palm","fume","plop","help","tuba","leap","cans","back","avid","lice","lust","polo","dory","stew","kate","rama","coke","bled","mugs","ajax","arts","drug","pena","cody","hole","sean","deck","guts","kong","bate","pitt","como","lyle","siam","rook","baby","jigs","bret","bark","lori","reba","sups","made","buzz","gnaw","alps","clay","post","viol","dina","card","lana","doff","yups","tons","live","kids","pair","yawl","name","oven","sirs","gyms","prig","down","leos","noon","nibs","cook","safe","cobb","raja","awes","sari","nerd","fold","lots","pete","deal","bias","zeal","girl","rage","cool","gout","whey","soak","thaw","bear","wing","nagy","well","oink","sven","kurt","etna","held","wood","high","feta","twee","ford","cave","knot","tory","ibis","yaks","vets","foxy","sank","cone","pius","tall","seem","wool","flap","gird","lore","coot","mewl","sere","real","puts","sell","nuts","foil","lilt","saga","heft","dyed","goat","spew","daze","frye","adds","glen","tojo","pixy","gobi","stop","tile","hiss","shed","hahn","baku","ahas","sill","swap","also","carr","manx","lime","debs","moat","eked","bola","pods","coon","lacy","tube","minx","buff","pres","clew","gaff","flee","burn","whom","cola","fret","purl","wick","wigs","donn","guys","toni","oxen","wite","vial","spam","huts","vats","lima","core","eula","thad","peon","erie","oats","boyd","cued","olaf","tams","secs","urey","wile","penn","bred","rill","vary","sues","mail","feds","aves","code","beam","reed","neil","hark","pols","gris","gods","mesa","test","coup","heed","dora","hied","tune","doze","pews","oaks","bloc","tips","maid","goof","four","woof","silo","bray","zest","kiss","yong","file","hilt","iris","tuns","lily","ears","pant","jury","taft","data","gild","pick","kook","colt","bohr","anal","asps","babe","bach","mash","biko","bowl","huey","jilt","goes","guff","bend","nike","tami","gosh","tike","gees","urge","path","bony","jude","lynn","lois","teas","dunn","elul","bonn","moms","bugs","slay","yeah","loan","hulk","lows","damn","nell","jung","avis","mane","waco","loin","knob","tyke","anna","hire","luau","tidy","nuns","pots","quid","exec","hans","hera","hush","shag","scot","moan","wald","ursa","lorn","hunk","loft","yore","alum","mows","slog","emma","spud","rice","worn","erma","need","bags","lark","kirk","pooh","dyes","area","dime","luvs","foch","refs","cast","alit","tugs","even","role","toed","caph","nigh","sony","bide","robs","folk","daft","past","blue","flaw","sana","fits","barr","riot","dots","lamp","cock","fibs","harp","tent","hate","mali","togs","gear","tues","bass","pros","numb","emus","hare","fate","wife","mean","pink","dune","ares","dine","oily","tony","czar","spay","push","glum","till","moth","glue","dive","scad","pops","woks","andy","leah","cusp","hair","alex","vibe","bulb","boll","firm","joys","tara","cole","levy","owen","chow","rump","jail","lapp","beet","slap","kith","more","maps","bond","hick","opus","rust","wist","shat","phil","snow","lott","lora","cary","mote","rift","oust","klee","goad","pith","heep","lupe","ivan","mimi","bald","fuse","cuts","lens","leer","eyry","know","razz","tare","pals","geek","greg","teen","clef","wags","weal","each","haft","nova","waif","rate","katy","yale","dale","leas","axum","quiz","pawn","fend","capt","laws","city","chad","coal","nail","zaps","sort","loci","less","spur","note","foes","fags","gulp","snap","bogs","wrap","dane","melt","ease","felt","shea","calm","star","swam","aery","year","plan","odin","curd","mira","mops","shit","davy","apes","inky","hues","lome","bits","vila","show","best","mice","gins","next","roan","ymir","mars","oman","wild","heal","plus","erin","rave","robe","fast","hutu","aver","jodi","alms","yams","zero","revs","wean","chic","self","jeep","jobs","waxy","duel","seek","spot","raps","pimp","adan","slam","tool","morn","futz","ewes","errs","knit","rung","kans","muff","huhs","tows","lest","meal","azov","gnus","agar","sips","sway","otis","tone","tate","epic","trio","tics","fade","lear","owns","robt","weds","five","lyon","terr","arno","mama","grey","disk","sept","sire","bart","saps","whoa","turk","stow","pyle","joni","zinc","negs","task","leif","ribs","malt","nine","bunt","grin","dona","nope","hams","some","molt","smit","sacs","joan","slav","lady","base","heck","list","take","herd","will","nubs","burg","hugs","peru","coif","zoos","nick","idol","levi","grub","roth","adam","elma","tags","tote","yaws","cali","mete","lula","cubs","prim","luna","jolt","span","pita","dodo","puss","deer","term","dolt","goon","gary","yarn","aims","just","rena","tine","cyst","meld","loki","wong","were","hung","maze","arid","cars","wolf","marx","faye","eave","raga","flow","neal","lone","anne","cage","tied","tilt","soto","opel","date","buns","dorm","kane","akin","ewer","drab","thai","jeer","grad","berm","rods","saki","grus","vast","late","lint","mule","risk","labs","snit","gala","find","spin","ired","slot","oafs","lies","mews","wino","milk","bout","onus","tram","jaws","peas","cleo","seat","gums","cold","vang","dewy","hood","rush","mack","yuan","odes","boos","jami","mare","plot","swab","borg","hays","form","mesh","mani","fife","good","gram","lion","myna","moor","skin","posh","burr","rime","done","ruts","pays","stem","ting","arty","slag","iron","ayes","stub","oral","gets","chid","yens","snub","ages","wide","bail","verb","lamb","bomb","army","yoke","gels","tits","bork","mils","nary","barn","hype","odom","avon","hewn","rios","cams","tact","boss","oleo","duke","eris","gwen","elms","deon","sims","quit","nest","font","dues","yeas","zeta","bevy","gent","torn","cups","worm","baum","axon","purr","vise","grew","govs","meat","chef","rest","lame"] + ), + 11 + ); + } +} diff --git a/src/problem/p0128_longest_consecutive_sequence.rs b/src/problem/p0128_longest_consecutive_sequence.rs new file mode 100644 index 00000000..d166d4ae --- /dev/null +++ b/src/problem/p0128_longest_consecutive_sequence.rs @@ -0,0 +1,68 @@ +/** + * [128] Longest Consecutive Sequence + * + * Given an unsorted array of integers nums, return the length of the longest consecutive elements sequence. + * + * Example 1: + * + * Input: nums = [100,4,200,1,3,2] + * Output: 4 + * Explanation: The longest consecutive elements sequence is [1, 2, 3, 4]. Therefore its length is 4. + * + * Example 2: + * + * Input: nums = [0,3,7,2,5,8,4,6,0,1] + * Output: 9 + * + * + * Constraints: + * + * 0 <= nums.length <= 10^4 + * -10^9 <= nums[i] <= 10^9 + * + * + * Follow up: Could you implement the O(n) solution? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/longest-consecutive-sequence/ +// discuss: https://leetcode.com/problems/longest-consecutive-sequence/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashSet; +impl Solution { + pub fn longest_consecutive(nums: Vec) -> i32 { + let mut num_set = HashSet::new(); + for &num in &nums { + num_set.insert(num); + } + + let mut longest = 0; + for &num in &nums { + if !num_set.contains(&(num-1)) { + // num can be a potential start of consecutive nums + let mut next = num + 1; + let mut count = 1; + while num_set.contains(&next) { + count += 1; + next += 1; + } + longest = std::cmp::max(longest, count); + } + } + + longest + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_128() { + assert_eq!(Solution::longest_consecutive(vec![100, 4, 200, 1, 3, 2]), 4) + } +} diff --git a/src/problem/p0129_sum_root_to_leaf_numbers.rs b/src/problem/p0129_sum_root_to_leaf_numbers.rs new file mode 100644 index 00000000..596e2932 --- /dev/null +++ b/src/problem/p0129_sum_root_to_leaf_numbers.rs @@ -0,0 +1,108 @@ +/** + * [129] Sum Root to Leaf Numbers + * + * You are given the root of a binary tree containing digits from 0 to 9 only. + * Each root-to-leaf path in the tree represents a number. + * + * For example, the root-to-leaf path 1 -> 2 -> 3 represents the number 123. + * + * Return the total sum of all root-to-leaf numbers. + * A leaf node is a node with no children. + * + * Example 1: + * + * Input: root = [1,2,3] + * Output: 25 + * Explanation: + * The root-to-leaf path 1->2 represents the number 12. + * The root-to-leaf path 1->3 represents the number 13. + * Therefore, sum = 12 + 13 = 25. + * + * Example 2: + * + * Input: root = [4,9,0,5,1] + * Output: 1026 + * Explanation: + * The root-to-leaf path 4->9->5 represents the number 495. + * The root-to-leaf path 4->9->1 represents the number 491. + * The root-to-leaf path 4->0 represents the number 40. + * Therefore, sum = 495 + 491 + 40 = 1026. + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [1, 1000]. + * 0 <= Node.val <= 9 + * The depth of the tree will not exceed 10. + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/sum-root-to-leaf-numbers/ +// discuss: https://leetcode.com/problems/sum-root-to-leaf-numbers/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::{borrow::Borrow, rc::Rc}; +use std::cell::RefCell; + +impl Solution { + + pub fn helper(node : Rc>, sum : i32) -> i32 { + let mut my_sum = sum * 10 + node.as_ref().borrow().val; + let mut all_sum = 0; + + let mut is_leaf = true; + if let Some(left_node) = node.as_ref().borrow().left.clone() { + all_sum += Self::helper(left_node, my_sum); + is_leaf = false; + } + + if let Some(right_node) = node.as_ref().borrow().right.clone() { + all_sum += Self::helper(right_node, my_sum); + is_leaf = false; + } + if is_leaf {my_sum} else {all_sum} + } + + pub fn sum_numbers(root: Option>>) -> i32 { + match(root) { + None => 0, + Some(node) => { + Self::helper(node, 0) + } + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_129() { + assert_eq!(Solution::sum_numbers(tree![1, 2, 3]), 25); + assert_eq!(Solution::sum_numbers(tree![4, 9, 0, 5, 1]), 1026); + } +} diff --git a/src/problem/p0130_surrounded_regions.rs b/src/problem/p0130_surrounded_regions.rs new file mode 100644 index 00000000..af8b25b8 --- /dev/null +++ b/src/problem/p0130_surrounded_regions.rs @@ -0,0 +1,231 @@ +use std::cell; + +/** + * [130] Surrounded Regions + * + * Given an m x n matrix board containing 'X' and 'O', capture all regions surrounded by 'X'. + * A region is captured by flipping all 'O's into 'X's in that surrounded region. + * + * Example 1: + * + * Input: board = [["X","X","X","X"],["X","O","O","X"],["X","X","O","X"],["X","O","X","X"]] + * Output: [["X","X","X","X"],["X","X","X","X"],["X","X","X","X"],["X","O","X","X"]] + * Explanation: Surrounded regions should not be on the border, which means that any 'O' on the border of the board are not flipped to 'X'. Any 'O' that is not on the border and it is not connected to an 'O' on the border will be flipped to 'X'. Two cells are connected if they are adjacent cells connected horizontally or vertically. + * + * Example 2: + * + * Input: board = [["X"]] + * Output: [["X"]] + * + * + * Constraints: + * + * m == board.length + * n == board[i].length + * 1 <= m, n <= 200 + * board[i][j] is 'X' or 'O'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/surrounded-regions/ +// discuss: https://leetcode.com/problems/surrounded-regions/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_border_zeroes(board: &Vec>) -> Vec<(usize, usize)> { + let mut result = vec![]; + let (row_count, col_count) = (board.len(), board[0].len()); + + board.iter().enumerate().for_each(|(row_idx, row)| { + row.iter().enumerate().for_each(|(col_idx, &cell_char)| { + let on_border = (row_idx == 0 || row_idx == row_count - 1 || col_idx == 0 || col_idx == col_count - 1); + if on_border && cell_char == 'O' { + result.push((row_idx, col_idx)); + } + }); + }); + result + } + + pub fn unsurrounded_zeroes(board: &Vec>, cur_route : &mut Vec<(usize, usize)>, pos: (i32, i32) ) { + let (row_count, col_count) = (board.len() as i32, board[0].len() as i32); + let (row_idx, col_idx) = pos; + + if 0 <= row_idx && row_idx < row_count && 0 <= col_idx && col_idx < col_count && board[row_idx as usize][col_idx as usize] == 'O' && !cur_route.contains(&(row_idx as usize, col_idx as usize)) { + cur_route.push((row_idx as usize, col_idx as usize)); + Self::unsurrounded_zeroes(board, cur_route, (row_idx-1, col_idx)); + Self::unsurrounded_zeroes(board, cur_route, (row_idx+1, col_idx)); + Self::unsurrounded_zeroes(board, cur_route, (row_idx, col_idx-1)); + Self::unsurrounded_zeroes(board, cur_route, (row_idx, col_idx+1)); + } + } + + pub fn solve(board: &mut Vec>) { + let border_zeroes = Self::find_border_zeroes(board); + + for start_pos in border_zeroes { + let row_idx = start_pos.0 as i32; + let col_idx = start_pos.1 as i32; + let mut route = vec![start_pos]; + Self::unsurrounded_zeroes(board, &mut route, (row_idx-1, col_idx)); + Self::unsurrounded_zeroes(board, &mut route, (row_idx+1, col_idx)); + Self::unsurrounded_zeroes(board, &mut route, (row_idx, col_idx-1)); + Self::unsurrounded_zeroes(board, &mut route, (row_idx, col_idx+1)); + + for (row_idx, col_idx) in route { + board[row_idx][col_idx] = '1'; // tmp change to 1 to avoid revisited. + } + } + + for i in 0..board.len() { + for j in 0..board[0].len() { + if board[i][j] == 'O' { + board[i][j] = 'X'; + } else if board[i][j] == '1' { + board[i][j] = 'O'; + } + } + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_130() { + let mut matrix = vec![ + vec!['X', 'X', 'X', 'X'], + vec!['X', 'O', 'O', 'X'], + vec!['X', 'X', 'O', 'X'], + vec!['X', 'O', 'X', 'X'], + ]; + Solution::solve(&mut matrix); + assert_eq!( + matrix, + vec![ + vec!['X', 'X', 'X', 'X'], + vec!['X', 'X', 'X', 'X'], + vec!['X', 'X', 'X', 'X'], + vec!['X', 'O', 'X', 'X'], + ] + ); + + let mut matrix = vec![ + vec!['X', 'X', 'X', 'X'], + vec!['X', 'O', 'O', 'X'], + vec!['X', 'O', 'O', 'X'], + vec!['X', 'X', 'X', 'X'], + ]; + Solution::solve(&mut matrix); + assert_eq!( + matrix, + vec![ + vec!['X', 'X', 'X', 'X'], + vec!['X', 'X', 'X', 'X'], + vec!['X', 'X', 'X', 'X'], + vec!['X', 'X', 'X', 'X'], + ] + ); + + let mut matrix = vec![ + vec!['X', 'X', 'X', 'X'], + vec!['O', 'X', 'O', 'X'], + vec!['O', 'X', 'O', 'X'], + vec!['X', 'O', 'X', 'X'], + ]; + Solution::solve(&mut matrix); + assert_eq!( + matrix, + vec![ + vec!['X', 'X', 'X', 'X'], + vec!['O', 'X', 'X', 'X'], + vec!['O', 'X', 'X', 'X'], + vec!['X', 'O', 'X', 'X'], + ] + ); + + let mut matrix = vec![ + vec!['X', 'X', 'X', 'X', 'O', 'X'], + vec!['O', 'X', 'X', 'O', 'O', 'X'], + vec!['X', 'O', 'X', 'O', 'O', 'O'], + vec!['X', 'O', 'O', 'O', 'X', 'O'], + vec!['O', 'O', 'X', 'X', 'O', 'X'], + vec!['X', 'O', 'X', 'O', 'X', 'X'], + ]; + Solution::solve(&mut matrix); + assert_eq!( + matrix, + vec![ + vec!['X', 'X', 'X', 'X', 'O', 'X'], + vec!['O', 'X', 'X', 'O', 'O', 'X'], + vec!['X', 'O', 'X', 'O', 'O', 'O'], + vec!['X', 'O', 'O', 'O', 'X', 'O'], + vec!['O', 'O', 'X', 'X', 'X', 'X'], + vec!['X', 'O', 'X', 'O', 'X', 'X'], + ] + ); + + let mut matrix = vec![ + vec![ + 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', + 'X', 'X', 'X', 'X', + ], + vec![ + 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'O', 'O', 'O', 'X', 'X', 'X', 'X', + 'X', 'X', 'X', 'X', + ], + vec![ + 'X', 'X', 'X', 'X', 'X', 'O', 'O', 'O', 'X', 'O', 'X', 'O', 'X', 'X', 'X', 'X', + 'X', 'X', 'X', 'X', + ], + vec![ + 'X', 'X', 'X', 'X', 'X', 'O', 'X', 'O', 'X', 'O', 'X', 'O', 'O', 'O', 'X', 'X', + 'X', 'X', 'X', 'X', + ], + vec![ + 'X', 'X', 'X', 'X', 'X', 'O', 'X', 'O', 'O', 'O', 'X', 'X', 'X', 'X', 'X', 'X', + 'X', 'X', 'X', 'X', + ], + vec![ + 'X', 'X', 'X', 'X', 'X', 'O', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', + 'X', 'X', 'X', 'X', + ], + ]; + Solution::solve(&mut matrix); + assert_eq!( + matrix, + vec![ + vec![ + 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', + 'X', 'X', 'X', 'X' + ], + vec![ + 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'O', 'O', 'O', 'X', 'X', 'X', 'X', + 'X', 'X', 'X', 'X' + ], + vec![ + 'X', 'X', 'X', 'X', 'X', 'O', 'O', 'O', 'X', 'O', 'X', 'O', 'X', 'X', 'X', 'X', + 'X', 'X', 'X', 'X' + ], + vec![ + 'X', 'X', 'X', 'X', 'X', 'O', 'X', 'O', 'X', 'O', 'X', 'O', 'O', 'O', 'X', 'X', + 'X', 'X', 'X', 'X' + ], + vec![ + 'X', 'X', 'X', 'X', 'X', 'O', 'X', 'O', 'O', 'O', 'X', 'X', 'X', 'X', 'X', 'X', + 'X', 'X', 'X', 'X' + ], + vec![ + 'X', 'X', 'X', 'X', 'X', 'O', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', 'X', + 'X', 'X', 'X', 'X' + ] + ] + ); + } +} diff --git a/src/problem/p0131_palindrome_partitioning.rs b/src/problem/p0131_palindrome_partitioning.rs new file mode 100644 index 00000000..eb48102b --- /dev/null +++ b/src/problem/p0131_palindrome_partitioning.rs @@ -0,0 +1,124 @@ +/** + * [131] Palindrome Partitioning + * + * Given a string s, partition s such that every substring of the partition is a palindrome. Return all possible palindrome partitioning of s. + * A palindrome string is a string that reads the same backward as forward. + * + * Example 1: + * Input: s = "aab" + * Output: [["a","a","b"],["aa","b"]] + * Example 2: + * Input: s = "a" + * Output: [["a"]] + * + * Constraints: + * + * 1 <= s.length <= 16 + * s contains only lowercase English letters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/palindrome-partitioning/ +// discuss: https://leetcode.com/problems/palindrome-partitioning/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn backtrack_helper(result : &mut Vec>, tmp : &mut Vec, elements : &Vec, predicate: P, parse: B, start : usize, no_dup : bool, element_reusable : bool) where P:Fn(&Vec)->(bool, bool) + Copy, B:Fn(&Vec,usize,usize)->Option + Copy, R:Clone +Eq + std::fmt::Debug, E:std::fmt::Debug{ + // is_sorted() is only supported in nightly-built rust + // if no_dup && !elements.is_sorted() { + // panic!("Elements must be presorted to deduplicate."); + // } + if no_dup && element_reusable { + panic!("element_reusable and no_dup can NOT be both on. "); + } + let (valid , early_stop) = predicate(tmp); + if valid { result.push(tmp.clone()); } + if early_stop {return} + + let n : usize = elements.len(); + let mut last_parsed : Option = None; + let mut start_parse_idx : usize = start; + for i in start..n { + let parsed : Option = parse(elements, start, i); + // println!("elements={:?}, start_idx={}, end={}, parsed={:?}", elements, start, i, parsed); + if parsed.is_none() { + continue; + } + let parsed : R = parsed.unwrap(); + + let mut backtrack = true; + if no_dup && last_parsed.is_some() && last_parsed.as_ref().unwrap().eq(&parsed) { + backtrack = false; + } + + if backtrack { + tmp.push(parsed.clone()); + let next_start = if element_reusable { start_parse_idx} else { i+1 }; + Self::backtrack_helper(result, tmp, elements, predicate, parse, next_start, no_dup, element_reusable); + tmp.pop(); + + } + last_parsed = Some(parsed.clone()); + start_parse_idx = i + 1; + } + } + + + + pub fn partition(s: String) -> Vec> { + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let element_reusable = false; + let no_dup = false; + + let predicate = |tmp : &Vec|{ + let early_stop = false; + let mut l = 0usize; + for t in tmp.iter() { + l+=t.len(); + } + (l==s.len(), early_stop) + }; + + let parse = |elements : &Vec, start_idx : usize, end_idx : usize|{ + // end_idx is inclusive + let chars : Vec = elements.iter().skip(start_idx).take(end_idx + 1 - start_idx).cloned().collect(); + let n = chars.len(); + for i in 0..n/2 { + if chars[i] != chars[n-1-i] {return None} + } + let parsed : String = chars.into_iter().collect(); + Some(parsed) + }; + + let elements : Vec = s.chars().collect(); + Self::backtrack_helper(&mut result, &mut tmp, &elements, predicate, parse, 0, no_dup, element_reusable); + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_131() { + assert_eq!( + Solution::partition("aab".to_owned()), + vec![ vec_string!["a", "a", "b"],vec_string!["aa", "b"],] + ); + assert_eq!( + Solution::partition("aaa".to_owned()), + vec![ + vec_string!["a", "a", "a"], + vec_string!["a", "aa"], + vec_string!["aa", "a"], + vec_string!["aaa"], + ] + ); + } +} diff --git a/src/problem/p0132_palindrome_partitioning_ii.rs b/src/problem/p0132_palindrome_partitioning_ii.rs new file mode 100644 index 00000000..ff0dac67 --- /dev/null +++ b/src/problem/p0132_palindrome_partitioning_ii.rs @@ -0,0 +1,152 @@ +/** + * [132] Palindrome Partitioning II + * + * Given a string s, partition s such that every substring of the partition is a palindrome. + * Return the minimum cuts needed for a palindrome partitioning of s. + * + * Example 1: + * + * Input: s = "aab" + * Output: 1 + * Explanation: The palindrome partitioning ["aa","b"] could be produced using 1 cut. + * + * Example 2: + * + * Input: s = "a" + * Output: 0 + * + * Example 3: + * + * Input: s = "ab" + * Output: 1 + * + * + * Constraints: + * + * 1 <= s.length <= 2000 + * s consists of lower-case English letters only. + * + */ +use std::collections::HashSet; +pub struct Solution { +} + +// problem: https://leetcode.com/problems/palindrome-partitioning-ii/ +// discuss: https://leetcode.com/problems/palindrome-partitioning-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn backtrack_helper(result : &mut Vec>, tmp : &mut Vec, elements : &Vec, predicate: P, parse: B, start : usize, no_dup : bool, element_reusable : bool) where P:Fn(&Vec>, &Vec)->(bool, bool) + Copy, B:Fn(&Vec,usize,usize)->Option + Copy, R:Clone +Eq + std::fmt::Debug, E:std::fmt::Debug{ + // is_sorted() is only supported in nightly-built rust + // if no_dup && !elements.is_sorted() { + // panic!("Elements must be presorted to deduplicate."); + // } + if no_dup && element_reusable { + panic!("element_reusable and no_dup can NOT be both on. "); + } + let (valid , early_stop) = predicate(result, tmp); + if valid { result.push(tmp.clone()); } + if early_stop {return} + + let n : usize = elements.len(); + let mut last_parsed : Option = None; + let mut start_parse_idx : usize = start; + for i in start..n { + let parsed : Option = parse(elements, start, i); + // println!("elements={:?}, start_idx={}, end={}, parsed={:?}", elements, start, i, parsed); + if parsed.is_none() { + continue; + } + let parsed : R = parsed.unwrap(); + + let mut backtrack = true; + if no_dup && last_parsed.is_some() && last_parsed.as_ref().unwrap().eq(&parsed) { + backtrack = false; + } + + if backtrack { + tmp.push(parsed.clone()); + let next_start = if element_reusable { start_parse_idx} else { i+1 }; + Self::backtrack_helper(result, tmp, elements, predicate, parse, next_start, no_dup, element_reusable); + tmp.pop(); + + } + last_parsed = Some(parsed.clone()); + start_parse_idx = i + 1; + } + } + + // May timeout + pub fn min_cut_recursive(s: String) -> i32 { + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let element_reusable = false; + let no_dup = false; + + let predicate = |result: &Vec>, tmp : &Vec|{ + let min_cut = result.iter().map(|r|{r.len()}).min(); + let cur_cut = tmp.len(); + let mut early_stop = false; + if min_cut.is_some() && min_cut.unwrap() <=cur_cut { + early_stop = true; + } + + let mut l = 0usize; + for t in tmp.iter() { + l+=t.len(); + } + (l==s.len(), early_stop) + }; + + let parse = |elements : &Vec, start_idx : usize, end_idx : usize|{ + // end_idx is inclusive + let chars : Vec = elements.iter().skip(start_idx).take(end_idx + 1 - start_idx).cloned().collect(); + let n = chars.len(); + for i in 0..n/2 { + if chars[i] != chars[n-1-i] {return None} + } + let parsed : String = chars.into_iter().collect(); + Some(parsed) + }; + + let elements : Vec = s.chars().collect(); + Self::backtrack_helper(&mut result, &mut tmp, &elements, predicate, parse, 0, no_dup, element_reusable); + (result.iter().map(|r|{r.len()}).min().unwrap() - 1) as i32 + } + + // with DP + pub fn min_cut(s: String) -> i32 { + let n = s.len() as i32; + let mut min_cuts = vec![n as usize;n as usize]; + let mut is_palindrome = HashSet::new(); + let s_chars : Vec = s.chars().collect(); + for end in 0..n {//inclusive + for start in 0..=end { + if s_chars[start as usize] == s_chars[end as usize] && (start+1>end-1||is_palindrome.contains(&(start+1,end-1))) { + is_palindrome.insert((start, end)); + if start == 0 { + min_cuts[end as usize] = 0; + } else { + min_cuts[end as usize] = std::cmp::min(min_cuts[end as usize], 1+min_cuts[start as usize-1]); + } + } + } + } + min_cuts[n as usize -1] as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_132() { + assert_eq!(Solution::min_cut("aab".to_owned()), 1); + assert_eq!(Solution::min_cut("aaa".to_owned()), 0); + assert_eq!(Solution::min_cut("aabb".to_owned()), 1); + } +} diff --git a/src/problem/p0135_candy.rs b/src/problem/p0135_candy.rs new file mode 100644 index 00000000..593a9544 --- /dev/null +++ b/src/problem/p0135_candy.rs @@ -0,0 +1,74 @@ +/** + * [135] Candy + * + * There are n children standing in a line. Each child is assigned a rating value given in the integer array ratings. + * You are giving candies to these children subjected to the following requirements: + * + * Each child must have at least one candy. + * Children with a higher rating get more candies than their neighbors. + * + * Return the minimum number of candies you need to have to distribute the candies to the children. + * + * Example 1: + * + * Input: ratings = [1,0,2] + * Output: 5 + * Explanation: You can allocate to the first, second and third child with 2, 1, 2 candies respectively. + * + * Example 2: + * + * Input: ratings = [1,2,2] + * Output: 4 + * Explanation: You can allocate to the first, second and third child with 1, 2, 1 candies respectively. + * The third child gets 1 candy because it satisfies the above two conditions. + * + * + * Constraints: + * + * n == ratings.length + * 1 <= n <= 2 * 10^4 + * 0 <= ratings[i] <= 2 * 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/candy/ +// discuss: https://leetcode.com/problems/candy/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn candy(ratings: Vec) -> i32 { + let n : usize = ratings.len(); + let mut result : Vec = vec![1i32;n]; + for i in 1..n { + if ratings[i-1] < ratings[i] { + result[i] = result[i-1] + 1; + } + } + + for i in (0..(n-1)).rev() { + if ratings[i] > ratings[i+1] { + result[i] = std::cmp::max(result[i], result[i+1] + 1); + } + } + result.iter().sum() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_135() { + assert_eq!(Solution::candy(vec![3, 2, 1, 2, 3]), 11); + assert_eq!(Solution::candy(vec![2, 2, 1, 2, 2]), 7); + assert_eq!(Solution::candy(vec![1, 0, 2]), 5); + assert_eq!(Solution::candy(vec![1, 2, 2]), 4); + assert_eq!(Solution::candy(vec![1, 1, 1, 1, 1, 1]), 6); + assert_eq!(Solution::candy(vec![1, 2, 2, 2, 2, 2, 2, 0]), 10); + } +} diff --git a/src/problem/p0136_single_number.rs b/src/problem/p0136_single_number.rs new file mode 100644 index 00000000..3e396e43 --- /dev/null +++ b/src/problem/p0136_single_number.rs @@ -0,0 +1,48 @@ +/** + * [136] Single Number + * + * Given a non-empty array of integers nums, every element appears twice except for one. Find that single one. + * Follow up: Could you implement a solution with a linear runtime complexity and without using extra memory? + * + * Example 1: + * Input: nums = [2,2,1] + * Output: 1 + * Example 2: + * Input: nums = [4,1,2,1,2] + * Output: 4 + * Example 3: + * Input: nums = [1] + * Output: 1 + * + * Constraints: + * + * 1 <= nums.length <= 3 * 10^4 + * -3 * 10^4 <= nums[i] <= 3 * 10^4 + * Each element in the array appears twice except for one element which appears only once. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/single-number/ +// discuss: https://leetcode.com/problems/single-number/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn single_number(nums: Vec) -> i32 { + nums.iter().fold(0, |acc,x|{acc^x}) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_136() { + assert_eq!(Solution::single_number(vec![2, 2, 1]), 1); + assert_eq!(Solution::single_number(vec![4, 1, 2, 1, 2]), 4); + } +} diff --git a/src/problem/p0137_single_number_ii.rs b/src/problem/p0137_single_number_ii.rs new file mode 100644 index 00000000..ed32a297 --- /dev/null +++ b/src/problem/p0137_single_number_ii.rs @@ -0,0 +1,66 @@ +/** + * [137] Single Number II + * + * Given an integer array nums where every element appears three times except for one, which appears exactly once. Find the single element and return it. + * + * Example 1: + * Input: nums = [2,2,3,2] + * Output: 3 + * Example 2: + * Input: nums = [0,1,0,1,0,1,99] + * Output: 99 + * + * Constraints: + * + * 1 <= nums.length <= 3 * 10^4 + * -2^31 <= nums[i] <= 2^31 - 1 + * Each element in nums appears exactly three times except for one element which appears once. + * + * + * Follow up: Your algorithm should have a linear runtime complexity. Could you implement it without using extra memory? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/single-number-ii/ +// discuss: https://leetcode.com/problems/single-number-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn single_number(nums: Vec) -> i32 { + // for each bit 0<=i<31, x1[i]x0[i] forms a cyclic counter with a period of 3. xj[i] stands for the i-th bit in xj. Each i corresponds to a counter. + + let mut x0 = 0; + let mut x1 = 0; + + for &num in &nums { + x1 ^= (x0 & num); + x0 ^= num; + + // for each i, mask[i]=0 if and only if x1[i]=x0[i], which implies the bit counter has reached to 3. + let mask = !(x1 & x0); + + // for each bit i/counter, reset to 0 if it reaches 0b11 (3). + x1&=mask; + x0&=mask; + } + // p=1 can be structured as 0b01. The 1-bit corresponds to x0, which can be proved equal to the single element e, as below: + // If e[i]=0, the i-th counter is always zero and hence xj[i]=e[i]=0 for any j. + // If e[i]=1, the i-th counter is incremented for p times and hence x1[i]x0[i]=p. Given p[j]=1, xj[i]=e[i]=1. + // Hence, as long as we select a j such that p[j]=1, xj[i]=e[i] for all i and xj=e + x0 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_137() { + assert_eq!(Solution::single_number(vec![0, 0, 0, 1, 1, 1, 5]), 5); + } +} diff --git a/src/problem/p0139_word_break.rs b/src/problem/p0139_word_break.rs new file mode 100644 index 00000000..331807de --- /dev/null +++ b/src/problem/p0139_word_break.rs @@ -0,0 +1,84 @@ +/** + * [139] Word Break + * + * Given a string s and a dictionary of strings wordDict, return true if s can be segmented into a space-separated sequence of one or more dictionary words. + * Note that the same word in the dictionary may be reused multiple times in the segmentation. + * + * Example 1: + * + * Input: s = "leetcode", wordDict = ["leet","code"] + * Output: true + * Explanation: Return true because "leetcode" can be segmented as "leet code". + * + * Example 2: + * + * Input: s = "applepenapple", wordDict = ["apple","pen"] + * Output: true + * Explanation: Return true because "applepenapple" can be segmented as "apple pen apple". + * Note that you are allowed to reuse a dictionary word. + * + * Example 3: + * + * Input: s = "catsandog", wordDict = ["cats","dog","sand","and","cat"] + * Output: false + * + * + * Constraints: + * + * 1 <= s.length <= 300 + * 1 <= wordDict.length <= 1000 + * 1 <= wordDict[i].length <= 20 + * s and wordDict[i] consist of only lowercase English letters. + * All the strings of wordDict are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/word-break/ +// discuss: https://leetcode.com/problems/word-break/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashSet; +impl Solution { + pub fn word_break(s: String, word_dict: Vec) -> bool { + let l : usize = s.len(); + let dict : HashSet = word_dict.into_iter().collect(); + let mut breakable : Vec = vec![false;l+1]; + breakable[0] = true; + + for i in 1..=l { + for start in 0..i { + let sub_str : String = s[start..i].to_string(); + // println!("i={}, start={}, sub_str={}", i, start, sub_str); + if breakable[start] && dict.contains(&sub_str) { + breakable[i] = true; + break; + } + } + } + + breakable[l] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_139() { + assert_eq!( + Solution::word_break("leetcode".to_owned(), vec_string!["leet", "code"]), + true + ); + assert_eq!( + Solution::word_break( + "catsandog".to_owned(), + vec_string!["cats", "dog", "sand", "and", "cat"] + ), + false + ); + } +} diff --git a/src/problem/p0140_word_break_ii.rs b/src/problem/p0140_word_break_ii.rs new file mode 100644 index 00000000..455c2549 --- /dev/null +++ b/src/problem/p0140_word_break_ii.rs @@ -0,0 +1,82 @@ +/** + * [140] Word Break II + * + * Given a string s and a dictionary of strings wordDict, add spaces in s to construct a sentence where each word is a valid dictionary word. Return all such possible sentences in any order. + * Note that the same word in the dictionary may be reused multiple times in the segmentation. + * + * Example 1: + * + * Input: s = "catsanddog", wordDict = ["cat","cats","and","sand","dog"] + * Output: ["cats and dog","cat sand dog"] + * + * Example 2: + * + * Input: s = "pineapplepenapple", wordDict = ["apple","pen","applepen","pine","pineapple"] + * Output: ["pine apple pen apple","pineapple pen apple","pine applepen apple"] + * Explanation: Note that you are allowed to reuse a dictionary word. + * + * Example 3: + * + * Input: s = "catsandog", wordDict = ["cats","dog","sand","and","cat"] + * Output: [] + * + * + * Constraints: + * + * 1 <= s.length <= 20 + * 1 <= wordDict.length <= 1000 + * 1 <= wordDict[i].length <= 10 + * s and wordDict[i] consist of only lowercase English letters. + * All the strings of wordDict are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/word-break-ii/ +// discuss: https://leetcode.com/problems/word-break-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashSet; +impl Solution { + pub fn recursive(result : &mut Vec>, tmp: &mut Vec, s : &String, cur_idx : usize, word_dict : &HashSet, level : usize) { + let pad :String = (0..level).map(|_|{" "}).collect(); + // println!("{}tmp={:?}, cur_idx={}", pad, tmp, cur_idx); + let n : usize = s.len(); + if n == cur_idx { + result.push(tmp.clone()); + return; + } + + // exclusive end + for end in (cur_idx+1)..=n { + let sub_str : String = s[cur_idx..end].to_owned(); + if word_dict.contains(&sub_str) { + tmp.push(sub_str); + Self::recursive(result, tmp, s, end, word_dict, level + 1); + tmp.pop(); + } + } + } + + + + pub fn word_break(s: String, word_dict: Vec) -> Vec { + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + let word_dict : HashSet = word_dict.into_iter().collect(); + Self::recursive(&mut result, &mut tmp, &s, 0, &word_dict, 0); + result.iter().map(|v|{v.join(" ")}).collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_140() { + assert_eq!(Solution::word_break("catsanddog".to_owned(), vec!["cat".to_owned(),"cats".to_owned(),"and".to_owned(),"sand".to_owned(),"dog".to_owned()]), vec!["cat sand dog".to_owned(),"cats and dog".to_owned()]); + } +} diff --git a/src/problem/p0143_reorder_list.rs b/src/problem/p0143_reorder_list.rs new file mode 100644 index 00000000..35d987df --- /dev/null +++ b/src/problem/p0143_reorder_list.rs @@ -0,0 +1,111 @@ +/** + * [143] Reorder List + * + * You are given the head of a singly linked-list. The list can be represented as: + * + * L0 → L1 → … → Ln - 1 → Ln + * + * Reorder the list to be on the following form: + * + * L0 → Ln → L1 → Ln - 1 → L2 → Ln - 2 → … + * + * You may not modify the values in the list's nodes. Only nodes themselves may be changed. + * + * Example 1: + * + * Input: head = [1,2,3,4] + * Output: [1,4,2,3] + * + * Example 2: + * + * Input: head = [1,2,3,4,5] + * Output: [1,5,2,4,3] + * + * + * Constraints: + * + * The number of nodes in the list is in the range [1, 5 * 10^4]. + * 1 <= Node.val <= 1000 + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/reorder-list/ +// discuss: https://leetcode.com/problems/reorder-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn reverse(head: Option>) -> Option> { + let mut reversed = None; + let mut unreversed = head; + while let Some(mut unreversed_node) = unreversed { + unreversed = unreversed_node.next; + unreversed_node.next = reversed; + reversed = Some(unreversed_node); + } + reversed + } + + pub fn merge(mut l1 : Option>, mut l2 : Option>) -> Option> { + // take turn to merge, where l1 is the first. + match(l1,l2) { + (None, None) => None, + (None, Some(l2_head)) => Some(l2_head), + (Some(l1_head), None) => Some(l1_head), + (Some(mut l1_head), Some(l2_head)) => { + l1_head.next = Self::merge(Some(l2_head), l1_head.next); + Some(l1_head) + } + } + } + + pub fn reorder_list(head: &mut Option>) { + // Separate list into two halves. + if let None = head {return} + let mut cur_node = head.as_ref().unwrap(); + let mut list_size = 1; + while cur_node.next.is_some() { + cur_node = cur_node.next.as_ref().unwrap(); + list_size+=1; + } + let mut step_to_mid = (list_size-1) / 2; + + let mut first_half_tail = head.as_mut().unwrap(); + while 0 < step_to_mid { + first_half_tail = first_half_tail.next.as_mut().unwrap(); + step_to_mid-=1; + } + let mut sec_half = first_half_tail.next.take(); + let mut sec_half_reversed = Self::reverse(sec_half); + + head.as_mut().unwrap().next = Self::merge(sec_half_reversed, head.as_mut().unwrap().next.take()); + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_143() {} +} diff --git a/src/problem/p0145_binary_tree_postorder_traversal.rs b/src/problem/p0145_binary_tree_postorder_traversal.rs new file mode 100644 index 00000000..e7da06d8 --- /dev/null +++ b/src/problem/p0145_binary_tree_postorder_traversal.rs @@ -0,0 +1,99 @@ +/** + * [145] Binary Tree Postorder Traversal + * + * Given the root of a binary tree, return the postorder traversal of its nodes' values. + * + * Example 1: + * + * Input: root = [1,null,2,3] + * Output: [3,2,1] + * + * Example 2: + * + * Input: root = [] + * Output: [] + * + * Example 3: + * + * Input: root = [1] + * Output: [1] + * + * Example 4: + * + * Input: root = [1,2] + * Output: [2,1] + * + * Example 5: + * + * Input: root = [1,null,2] + * Output: [2,1] + * + * + * Constraints: + * + * The number of the nodes in the tree is in the range [0, 100]. + * -100 <= Node.val <= 100 + * + * + * Follow up: + * Recursive solution is trivial, could you do it iteratively? + * + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/binary-tree-postorder-traversal/ +// discuss: https://leetcode.com/problems/binary-tree-postorder-traversal/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn postorder_traversal(root: Option>>) -> Vec { + match(root) { + None=>{vec![]}, + Some(node)=>{ + let mut left_vec = Self::postorder_traversal(node.borrow_mut().left.take()); + let mut right_vec = Self::postorder_traversal(node.borrow_mut().right.take()); + left_vec.extend(right_vec); + left_vec.extend(vec![node.borrow().val]); + left_vec + } + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_145() { + assert_eq!( + Solution::postorder_traversal(tree![1, null, 2, 3]), + vec![3, 2, 1] + ); + } +} diff --git a/src/problem/p0146_lru_cache.py b/src/problem/p0146_lru_cache.py new file mode 100644 index 00000000..b0898f83 --- /dev/null +++ b/src/problem/p0146_lru_cache.py @@ -0,0 +1,118 @@ +class LRUNode(object): + def __init__(self, key, val): + self.key = key + self.val = val + self.next = self + self.prev = self + + +class LRUCache(object): + + def __init__(self, capacity): + """ + :type capacity: int + """ + self.cap = capacity + self.key2nodes = {} + self.head = 0 + self.tail = 0 + + + def get(self, key): + """ + :type key: int + :rtype: int + """ + if key in self.key2nodes: + node = self.key2nodes[key] + self.detach(node) + self.push(node) + # print("AFTER GET key={}, key2nodes={}, head.key={}, tail.key={}".format(key, self.key2nodes, self.head.key, self.tail.key)) + + return node.val + + else: + return -1 + + + + def put(self, key, value): + """ + :type key: int + :type value: int + :rtype: None + """ + if key in self.key2nodes: + node = self.key2nodes[key] + node.val = value; + self.detach(node) + self.push(node) + else: + node = LRUNode(key,value) + self.push(node) + self.key2nodes[key] = node + + if len(self.key2nodes) > self.cap: + self.pop_last() + # print("AFTER PUT key={}, value={}, key2nodes={}, head.key={}, tail.key={}".format(key, value, self.key2nodes, self.head.key, self.tail.key)) + + + def detach(self, node): + if len(self.key2nodes) == 1: + self.head = 0 + self.tail = 0 + node.next = node + node.prev = node + del self.key2nodes[node.key] + + return + del self.key2nodes[node.key] + + # prev <-> node <-> next + # prev <-> next. + prev = node.prev + next = node.next + prev.next = next + next.prev = prev + + if node == self.tail: + self.tail = prev + if node == self.head: + self.head = next + + + def push(self, node): + + if self.head == 0: + self.head = node + self.tail = node + node.prev = node + node.next = node + self.key2nodes[node.key] = node + + return + + # tail <-> head + # tail <-> node <-> head + self.tail.next = node + node.prev = self.tail + self.head.prev = node + node.next = self.head + self.head = node + self.key2nodes[node.key] = node + + def pop_last(self): + # prev <-> tail <-> head + # prev <-> head + prev = self.tail.prev + prev.next = self.head + self.head.prev = prev + del self.key2nodes[self.tail.key] + self.tail = prev + + + +# Your LRUCache object will be instantiated and called as such: +# obj = LRUCache(capacity) +# param_1 = obj.get(key) +# obj.put(key,value) \ No newline at end of file diff --git a/src/problem/p0147_insertion_sort_list.rs b/src/problem/p0147_insertion_sort_list.rs new file mode 100644 index 00000000..ed1a2c42 --- /dev/null +++ b/src/problem/p0147_insertion_sort_list.rs @@ -0,0 +1,85 @@ +/** + * [147] Insertion Sort List + * + * Given the head of a singly linked list, sort the list using insertion sort, and return the sorted list's head. + * The steps of the insertion sort algorithm: + *
    + * Insertion sort iterates, consuming one input element each repetition and growing a sorted output list. + * At each iteration, insertion sort removes one element from the input data, finds the location it belongs within the sorted list and inserts it there. + * It repeats until no input elements remain. + *
+ * The following is a graphical example of the insertion sort algorithm. The partially sorted list (black) initially contains only the first element in the list. One element (red) is removed from the input data and inserted in-place into the sorted list with each iteration. + * + * + * Example 1: + * + * Input: head = [4,2,1,3] + * Output: [1,2,3,4] + * + * Example 2: + * + * Input: head = [-1,5,3,4,0] + * Output: [-1,0,3,4,5] + * + * + * Constraints: + * + * The number of nodes in the list is in the range [1, 5000]. + * -5000 <= Node.val <= 5000 + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/insertion-sort-list/ +// discuss: https://leetcode.com/problems/insertion-sort-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn insertion_sort_list(mut head: Option>) -> Option> { + let mut sorted = Some(Box::new(ListNode::new(-10000000))); + while let Some(mut unsorted_node) = head { + head = unsorted_node.next.take(); + + let mut sorted_node = sorted.as_mut().unwrap(); + while let Some(ref next_node) = sorted_node.next { + if unsorted_node.val < next_node.val { + break + } + sorted_node = sorted_node.next.as_mut().unwrap(); + } + let tmp = sorted_node.next.take(); + unsorted_node.next = tmp; + sorted_node.next = Some(unsorted_node) + } + + sorted.unwrap().next + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_147() {} +} diff --git a/src/problem/p0148_sort_list.rs b/src/problem/p0148_sort_list.rs new file mode 100644 index 00000000..728a8203 --- /dev/null +++ b/src/problem/p0148_sort_list.rs @@ -0,0 +1,113 @@ +/** + * [148] Sort List + * + * Given the head of a linked list, return the list after sorting it in ascending order. + * Follow up: Can you sort the linked list in O(n logn) time and O(1) memory (i.e. constant space)? + * + * Example 1: + * + * Input: head = [4,2,1,3] + * Output: [1,2,3,4] + * + * Example 2: + * + * Input: head = [-1,5,3,4,0] + * Output: [-1,0,3,4,5] + * + * Example 3: + * + * Input: head = [] + * Output: [] + * + * + * Constraints: + * + * The number of nodes in the list is in the range [0, 5 * 10^4]. + * -10^5 <= Node.val <= 10^5 + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/sort-list/ +// discuss: https://leetcode.com/problems/sort-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn merge_sorted(l1: Option>, l2: Option>) -> Option> { + match(l1,l2) { + (None, None)=>None, + (Some(l1_node), None) => {Some(l1_node)}, + (None, Some(l2_node)) => {Some(l2_node)}, + (Some(mut l1_node), Some(mut l2_node)) => { + if l1_node.val < l2_node.val { + l1_node.next = Self::merge_sorted(l1_node.next, Some(l2_node)); + Some(l1_node) + } else { + l2_node.next = Self::merge_sorted(Some(l1_node), l2_node.next); + Some(l2_node) + } + }, + } + } + + pub fn sort_list(mut head: Option>) -> Option> { + if head.is_none() {return None;} + if head.as_ref().unwrap().next.is_none() {return head;} + let mut list_len = 0; + let mut cur_head = head.as_ref(); + while let Some(cur_node) = cur_head { + cur_head = cur_node.next.as_ref(); + list_len += 1; + } + + let mut step_to_mid = (list_len - 1) / 2; + let mut first_half_tail = head.as_mut(); + while 0 < step_to_mid { + first_half_tail = first_half_tail.unwrap().next.as_mut(); + step_to_mid-=1; + } + + let sec_half = first_half_tail.unwrap().next.take(); + let sorted_sec_half = Self::sort_list(sec_half); + let sorted_first_half = Self::sort_list(head); + Self::merge_sorted(sorted_first_half, sorted_sec_half) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_148() { + assert_eq!( + Solution::sort_list(linked![4, 2, 1, 3]), + linked![1, 2, 3, 4] + ); + // assert_eq!( + // Solution::sort_list(linked![-1, 5, 3, 4, 0]), + // linked![-1, 0, 3, 4, 5] + // ); + // assert_eq!(Solution::sort_list(linked![]), linked![]); + } +} diff --git a/src/problem/p0149_max_points_on_a_line.rs b/src/problem/p0149_max_points_on_a_line.rs new file mode 100644 index 00000000..e083e2c7 --- /dev/null +++ b/src/problem/p0149_max_points_on_a_line.rs @@ -0,0 +1,119 @@ +/** + * [149] Max Points on a Line + * + * Given an array of points where points[i] = [xi, yi] represents a point on the X-Y plane, return the maximum number of points that lie on the same straight line. + * + * Example 1: + * + * Input: points = [[1,1],[2,2],[3,3]] + * Output: 3 + * + * Example 2: + * + * Input: points = [[1,1],[3,2],[5,3],[4,1],[2,3],[1,4]] + * Output: 4 + * + * + * Constraints: + * + * 1 <= points.length <= 300 + * points[i].length == 2 + * -10^4 <= xi, yi <= 10^4 + * All the points are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/max-points-on-a-line/ +// discuss: https://leetcode.com/problems/max-points-on-a-line/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn gcd(a:i32, b:i32) -> i32 {if b==0 {a} else {Self::gcd(b, a%b)}} + + pub fn max_points(points: Vec>) -> i32 { + let n = points.len(); + let mut max : usize = 1; + for i in 0..n-1 { + let mut counter_per_slope : HashMap<(i32, i32), usize> = HashMap::new(); + let mut i_overlap_count : usize = 0; + for j in (i+1)..n { + let dx : i32 = points[j][0] - points[i][0]; + let dy : i32 = points[j][1] - points[i][1]; + if dx == 0 && dy == 0 {i_overlap_count+=1;continue} + let d_gcd : i32 = Self::gcd(dx, dy); + let dx : i32 = dx / d_gcd; + let dy : i32 = dy / d_gcd; + *counter_per_slope.entry((dx,dy)).or_insert(0) += 1; + // println!("i={},j={},dx={},dy={}, count={}", i, j, dx, dy, counter_per_slope[&(dx,dy)]); + } + let mut i_max : usize = 0; + if let Some(&m) = counter_per_slope.values().max() { + i_max = m; + } + max = std::cmp::max(max, i_max + i_overlap_count + 1); + } + max as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_149() { + assert_eq!( + Solution::max_points(vec![vec![1, 1], vec![2, 2], vec![3, 3]]), + 3 + ); + assert_eq!( + Solution::max_points(vec![ + vec![1, 1], + vec![3, 2], + vec![5, 3], + vec![4, 1], + vec![2, 3], + vec![1, 4] + ]), + 4 + ); + assert_eq!( + Solution::max_points(vec![vec![0, 0], vec![1, 65536], vec![65536, 0]]), + 2 + ); + assert_eq!( + Solution::max_points(vec![vec![1, 1], vec![1, 1], vec![1, 1]]), + 3 + ); + assert_eq!( + Solution::max_points(vec![ + vec![0, 9], + vec![138, 429], + vec![115, 359], + vec![115, 359], + vec![-30, -102], + vec![230, 709], + vec![-150, -686], + vec![-135, -613], + vec![-60, -248], + vec![-161, -481], + vec![207, 639], + vec![23, 79], + vec![-230, -691], + vec![-115, -341], + vec![92, 289], + vec![60, 336], + vec![-105, -467], + vec![135, 701], + vec![-90, -394], + vec![-184, -551], + vec![150, 774] + ]), + 12 + ) + } +} diff --git a/src/problem/p0150_evaluate_reverse_polish_notation.rs b/src/problem/p0150_evaluate_reverse_polish_notation.rs new file mode 100644 index 00000000..f7eaee4e --- /dev/null +++ b/src/problem/p0150_evaluate_reverse_polish_notation.rs @@ -0,0 +1,99 @@ +/** + * [150] Evaluate Reverse Polish Notation + * + * Evaluate the value of an arithmetic expression in Reverse Polish Notation. + * Valid operators are +, -, *, and /. Each operand may be an integer or another expression. + * Note that division between two integers should truncate toward zero. + * It is guaranteed that the given RPN expression is always valid. That means the expression would always evaluate to a result, and there will not be any division by zero operation. + * + * Example 1: + * + * Input: tokens = ["2","1","+","3","*"] + * Output: 9 + * Explanation: ((2 + 1) * 3) = 9 + * + * Example 2: + * + * Input: tokens = ["4","13","5","/","+"] + * Output: 6 + * Explanation: (4 + (13 / 5)) = 6 + * + * Example 3: + * + * Input: tokens = ["10","6","9","3","+","-11","*","/","*","17","+","5","+"] + * Output: 22 + * Explanation: ((10 * (6 / ((9 + 3) * -11))) + 17) + 5 + * = ((10 * (6 / (12 * -11))) + 17) + 5 + * = ((10 * (6 / -132)) + 17) + 5 + * = ((10 * 0) + 17) + 5 + * = (0 + 17) + 5 + * = 17 + 5 + * = 22 + * + * + * Constraints: + * + * 1 <= tokens.length <= 10^4 + * tokens[i] is either an operator: "+", "-", "*", or "/", or an integer in the range [-200, 200]. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/evaluate-reverse-polish-notation/ +// discuss: https://leetcode.com/problems/evaluate-reverse-polish-notation/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn eval_rpn(tokens: Vec) -> i32 { + let mut stack = vec![]; + for element in &tokens { + match(element.as_str()) { + "+"=>{ + let op1 = stack.pop(); + let op2 = stack.pop(); + stack.push(op1.unwrap() + op2.unwrap()); + }, + + "-"=>{ + let op1 = stack.pop(); + let op2 = stack.pop(); + stack.push(op2.unwrap() - op1.unwrap()); + }, + + "*"=>{ + let op1 = stack.pop(); + let op2 = stack.pop(); + stack.push(op1.unwrap() * op2.unwrap()); + }, + + "/"=>{ + let op1 = stack.pop(); + let op2 = stack.pop(); + stack.push(op2.unwrap() / op1.unwrap()); + }, + _ => { + stack.push(element.parse::().unwrap()); + } + }; + } + stack[0] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_150() { + assert_eq!( + Solution::eval_rpn(vec_string![ + "10", "6", "9", "3", "+", "-11", "*", "/", "*", "17", "+", "5", "+" + ]), + 22 + ); + } +} diff --git a/src/problem/p0151_reverse_words_in_a_string.rs b/src/problem/p0151_reverse_words_in_a_string.rs new file mode 100644 index 00000000..dcdd3940 --- /dev/null +++ b/src/problem/p0151_reverse_words_in_a_string.rs @@ -0,0 +1,112 @@ +/** + * [151] Reverse Words in a String + * + * Given an input string s, reverse the order of the words. + * A word is defined as a sequence of non-space characters. The words in s will be separated by at least one space. + * Return a string of the words in reverse order concatenated by a single space. + * Note that s may contain leading or trailing spaces or multiple spaces between two words. The returned string should only have a single space separating the words. Do not include any extra spaces. + * + * Example 1: + * + * Input: s = "the sky is blue" + * Output: "blue is sky the" + * + * Example 2: + * + * Input: s = " hello world " + * Output: "world hello" + * Explanation: Your reversed string should not contain leading or trailing spaces. + * + * Example 3: + * + * Input: s = "a good example" + * Output: "example good a" + * Explanation: You need to reduce multiple spaces between two words to a single space in the reversed string. + * + * Example 4: + * + * Input: s = " Bob Loves Alice " + * Output: "Alice Loves Bob" + * + * Example 5: + * + * Input: s = "Alice does not even like bob" + * Output: "bob like even not does Alice" + * + * + * Constraints: + * + * 1 <= s.length <= 10^4 + * s contains English letters (upper-case and lower-case), digits, and spaces ' '. + * There is at least one word in s. + * + * + * Follow up: Could you solve it in-place with O(1) extra space? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/reverse-words-in-a-string/ +// discuss: https://leetcode.com/problems/reverse-words-in-a-string/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +impl Solution { + pub fn reverse_words(s: String) -> String { + let mut words = vec![]; + let (mut word_start, mut word_end) : (usize, usize) = (0, 1); // (inclusive, exclusive) + + loop { + // move word_start to the first non-space char + // println!("word_start = {}, word_end = {}", word_start, word_end); + + while let Some(cur_char) = s.chars().nth(word_start) { + if cur_char != ' ' { + break + } + word_start+=1; + } + if word_start == s.len() { + // End of str + break + } else { + word_end = word_start + 1; + } + + // move word_end to the first space char + while let Some(cur_char) = s.chars().nth(word_end) { + if cur_char == ' ' { + break + } + word_end+=1; + } + + let word : String = s.chars().skip(word_start).take(word_end-word_start).collect(); + words.push(word); + + word_start = word_end; + word_end = word_start+1; + + } + words.reverse(); + words.join(" ") + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_151() { + assert_eq!( + Solution::reverse_words("the sky is blue".to_owned()), + "blue is sky the".to_owned() + ); + assert_eq!( + Solution::reverse_words(" hello world! ".to_owned()), + "world! hello".to_owned() + ); + } +} diff --git a/src/problem/p0152_maximum_product_subarray.rs b/src/problem/p0152_maximum_product_subarray.rs new file mode 100644 index 00000000..c2cf125b --- /dev/null +++ b/src/problem/p0152_maximum_product_subarray.rs @@ -0,0 +1,97 @@ +/** + * [152] Maximum Product Subarray + * + * Given an integer array nums, find a contiguous non-empty subarray within the array that has the largest product, and return the product. + * It is guaranteed that the answer will fit in a 32-bit integer. + * A subarray is a contiguous subsequence of the array. + * + * Example 1: + * + * Input: nums = [2,3,-2,4] + * Output: 6 + * Explanation: [2,3] has the largest product 6. + * + * Example 2: + * + * Input: nums = [-2,0,-1] + * Output: 0 + * Explanation: The result cannot be 2, because [-2,-1] is not a subarray. + * + * + * Constraints: + * + * 1 <= nums.length <= 2 * 10^4 + * -10 <= nums[i] <= 10 + * The product of any prefix or suffix of nums is guaranteed to fit in a 32-bit integer. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/maximum-product-subarray/ +// discuss: https://leetcode.com/problems/maximum-product-subarray/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn max_product(nums: Vec) -> i32 { + let mut pre_max_pos : Option = None; + let mut pre_max_neg : Option = None; + let mut max_all : i32 = -20; + for &num in nums.iter() { + if num == 0 { + pre_max_pos = None; + pre_max_neg = None; + max_all = std::cmp::max(max_all, 0); + } else if num > 0 { + if let Some(pre_max_pos_val) = pre_max_pos { + pre_max_pos = Some(pre_max_pos_val * num); + } else { + pre_max_pos = Some(num); + } + + if let Some(pre_max_neg_val) = pre_max_neg { + pre_max_neg = Some(pre_max_neg_val * num); + } + } else { + let last_pre_max_pos = pre_max_pos; + let last_pre_max_neg = pre_max_neg; + + if let Some(last_pre_max_neg_val) = last_pre_max_neg { + pre_max_pos = Some(last_pre_max_neg_val * num); + } else { + pre_max_pos = None; + } + + if let Some(last_pre_max_pos_val) = last_pre_max_pos { + pre_max_neg = Some(last_pre_max_pos_val * num); + } else { + pre_max_neg = Some(num); + } + } + + if let Some(pre_max_neg_val) = pre_max_neg { + max_all = std::cmp::max(max_all, pre_max_neg_val); + } + + if let Some(pre_max_pos_val) = pre_max_pos { + max_all = std::cmp::max(max_all, pre_max_pos_val); + } + } + max_all + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_152() { + assert_eq!(Solution::max_product(vec![2, 3, -2, 4]), 6); + assert_eq!(Solution::max_product(vec![-2, 0, -1]), 0); + assert_eq!(Solution::max_product(vec![-4, -3, -2]), 12); + assert_eq!(Solution::max_product(vec![-2]), -2); + } +} diff --git a/src/problem/p0153_find_minimum_in_rotated_sorted_array.rs b/src/problem/p0153_find_minimum_in_rotated_sorted_array.rs new file mode 100644 index 00000000..8a8bc850 --- /dev/null +++ b/src/problem/p0153_find_minimum_in_rotated_sorted_array.rs @@ -0,0 +1,77 @@ +/** + * [153] Find Minimum in Rotated Sorted Array + * + * Suppose an array of length n sorted in ascending order is rotated between 1 and n times. For example, the array nums = [0,1,2,4,5,6,7] might become: + * + * [4,5,6,7,0,1,2] if it was rotated 4 times. + * [0,1,2,4,5,6,7] if it was rotated 7 times. + * + * Notice that rotating an array [a[0], a[1], a[2], ..., a[n-1]] 1 time results in the array [a[n-1], a[0], a[1], a[2], ..., a[n-2]]. + * Given the sorted rotated array nums of unique elements, return the minimum element of this array. + * + * Example 1: + * + * Input: nums = [3,4,5,1,2] + * Output: 1 + * Explanation: The original array was [1,2,3,4,5] rotated 3 times. + * + * Example 2: + * + * Input: nums = [4,5,6,7,0,1,2] + * Output: 0 + * Explanation: The original array was [0,1,2,4,5,6,7] and it was rotated 4 times. + * + * Example 3: + * + * Input: nums = [11,13,15,17] + * Output: 11 + * Explanation: The original array was [11,13,15,17] and it was rotated 4 times. + * + * + * Constraints: + * + * n == nums.length + * 1 <= n <= 5000 + * -5000 <= nums[i] <= 5000 + * All the integers of nums are unique. + * nums is sorted and rotated between 1 and n times. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/find-minimum-in-rotated-sorted-array/ +// discuss: https://leetcode.com/problems/find-minimum-in-rotated-sorted-array/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_min(nums: Vec) -> i32 { + let mut low = 0i32; + let n = nums.len() as i32; + let mut high = n - 1; + while low < high { + let mid : i32 = (low + high) / 2; + if nums[mid as usize] < nums[high as usize] { + high = mid; + } else { + low = mid + 1; + } + } + + nums[low as usize] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_153() { + assert_eq!(Solution::find_min(vec![4, 5, 6, 1, 2, 3]), 1); + assert_eq!(Solution::find_min(vec![4, 5, 6, 7, 0, 1, 2]), 0); + assert_eq!(Solution::find_min(vec![11,13,15,17]), 11); + } +} diff --git a/src/problem/p0154_find_minimum_in_rotated_sorted_array_ii.rs b/src/problem/p0154_find_minimum_in_rotated_sorted_array_ii.rs new file mode 100644 index 00000000..0e1a3c98 --- /dev/null +++ b/src/problem/p0154_find_minimum_in_rotated_sorted_array_ii.rs @@ -0,0 +1,80 @@ +/** + * [154] Find Minimum in Rotated Sorted Array II + * + * Suppose an array of length n sorted in ascending order is rotated between 1 and n times. For example, the array nums = [0,1,4,4,5,6,7] might become: + * + * [4,5,6,7,0,1,4] if it was rotated 4 times. + * [0,1,4,4,5,6,7] if it was rotated 7 times. + * + * Notice that rotating an array [a[0], a[1], a[2], ..., a[n-1]] 1 time results in the array [a[n-1], a[0], a[1], a[2], ..., a[n-2]]. + * Given the sorted rotated array nums that may contain duplicates, return the minimum element of this array. + * + * Example 1: + * Input: nums = [1,3,5] + * Output: 1 + * Example 2: + * Input: nums = [2,2,2,0,1] + * Output: 0 + * + * Constraints: + * + * n == nums.length + * 1 <= n <= 5000 + * -5000 <= nums[i] <= 5000 + * nums is sorted and rotated between 1 and n times. + * + * + * Follow up: This is the same as Find Minimum in Rotated Sorted Array but with duplicates. Would allow duplicates affect the run-time complexity? How and why? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/find-minimum-in-rotated-sorted-array-ii/ +// discuss: https://leetcode.com/problems/find-minimum-in-rotated-sorted-array-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + + pub fn find_min(mut nums: Vec) -> i32 { + let mut min : i32 = 5000; + let mut left : i32 = 0i32; + let mut right : i32 = nums.len() as i32 - 1; + while left <= right { + let mid : i32 = (left + right) / 2; + let left_num = nums[left as usize]; + let mid_num = nums[mid as usize]; + let right_num = nums[right as usize]; + + if left_num < mid_num { + //[left, mid] is non-decreasing + min = std::cmp::min(min, left_num); + left = mid + 1; + } else if left_num > mid_num { + //[mid, right] is non-decreasing + min = std::cmp::min(min, mid_num); + right = mid - 1; + } else { + min = std::cmp::min(min, left_num); + left += 1; + } + } + min + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_154() { + assert_eq!(Solution::find_min(vec![1, 2, 2, 2, 2, 2]), 1); + assert_eq!(Solution::find_min(vec![1, 3, 3]), 1); + assert_eq!(Solution::find_min(vec![3, 1, 3, 3]), 1); + assert_eq!(Solution::find_min(vec![1, 1]), 1); + assert_eq!(Solution::find_min(vec![3, 3, 3, 1]), 1); + assert_eq!(Solution::find_min(vec![3, 1, 1]), 1); + } +} diff --git a/src/problem/p0162_find_peak_element.rs b/src/problem/p0162_find_peak_element.rs new file mode 100644 index 00000000..e6ea564a --- /dev/null +++ b/src/problem/p0162_find_peak_element.rs @@ -0,0 +1,96 @@ +/** + * [162] Find Peak Element + * + * A peak element is an element that is strictly greater than its neighbors. + * Given an integer array nums, find a peak element, and return its index. If the array contains multiple peaks, return the index to any of the peaks. + * You may imagine that nums[-1] = nums[n] = -∞. + * + * Example 1: + * + * Input: nums = [1,2,3,1] + * Output: 2 + * Explanation: 3 is a peak element and your function should return the index number 2. + * Example 2: + * + * Input: nums = [1,2,1,3,5,6,4] + * Output: 5 + * Explanation: Your function can return either index number 1 where the peak element is 2, or index number 5 where the peak element is 6. + * + * Constraints: + * + * 1 <= nums.length <= 1000 + * -2^31 <= nums[i] <= 2^31 - 1 + * nums[i] != nums[i + 1] for all valid i. + * + * + * Follow up: Could you implement a solution with logarithmic complexity? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/find-peak-element/ +// discuss: https://leetcode.com/problems/find-peak-element/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn helper(nums: &Vec, start: usize, end: usize) -> i32 { + // nums has at least 2 elements. + println!("start={}, end={}", start, end); + if start >= end { + return -1; // not found. + } + + let mid = (start + end) / 2; + + if mid == 0 { + if nums[mid] > nums[mid+1] { + return mid as i32; + } else { + return Self::helper(nums, mid+1, end); + } + } else if mid == nums.len() - 1 { + if nums[mid-1] < nums[mid] { + return mid as i32; + } else { + return Self::helper(nums, start, mid); + } + } else { + if nums[mid-1] < nums[mid] && nums[mid] > nums[mid+1] { + return mid as i32; + } else if nums[mid-1] > nums[mid] { + return Self::helper(nums, start, mid); + } else if nums[mid] < nums[mid+1] && mid + 1 < end { + return Self::helper(nums, mid+1, end); + } else if nums[mid-1] == nums[mid] { + let left = Self::helper(nums, start, mid); + if left != -1 { + return left; + } else { + return Self::helper(nums, mid+1, end); + } + } + panic!("Shall not reach here"); + } + } + + pub fn find_peak_element(nums: Vec) -> i32 { + if nums.len() == 1 { + return 0 + } else { + return Self::helper(&nums, 0, nums.len()); + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_162() { + // assert_eq!(Solution::find_peak_element(vec![1, 2, 3, 1]), 2); + assert_eq!(Solution::find_peak_element(vec![1, 2, 1, 3, 5, 6, 4]), 5); + } +} diff --git a/src/problem/p0164_maximum_gap.rs b/src/problem/p0164_maximum_gap.rs new file mode 100644 index 00000000..df1e4c79 --- /dev/null +++ b/src/problem/p0164_maximum_gap.rs @@ -0,0 +1,80 @@ +/** + * [164] Maximum Gap + * + * Given an integer array nums, return the maximum difference between two successive elements in its sorted form. If the array contains less than two elements, return 0. + * + * Example 1: + * + * Input: nums = [3,6,9,1] + * Output: 3 + * Explanation: The sorted form of the array is [1,3,6,9], either (3,6) or (6,9) has the maximum difference 3. + * + * Example 2: + * + * Input: nums = [10] + * Output: 0 + * Explanation: The array contains less than 2 elements, therefore return 0. + * + * + * Constraints: + * + * 1 <= nums.length <= 10^4 + * 0 <= nums[i] <= 10^9 + * + * + * Follow up: Could you solve it in linear time/space? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/maximum-gap/ +// discuss: https://leetcode.com/problems/maximum-gap/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn maximum_gap(nums: Vec) -> i32 { + if nums.len() == 1{return 0}; + let max_num = *nums.iter().max().unwrap(); + let min_num = *nums.iter().min().unwrap(); + if nums.len() == 2{return max_num - min_num}; + + // prepare for n-1 buckets with at most n - 2 values, excluding min and max. + // As there exists at least one empty bucket, the max gap must appear for the max of a bucket and the min of a next bucket. This is because the diff between nums in the same bucket is within the bucket gap. + let n = nums.len() as i32; + // ceil division + let bucket_gap = if (max_num - min_num) % (n-2) == 0 {(max_num - min_num) / (n-2)} else {(max_num - min_num) / (n-2)+1}; + + let mut bucket_min = vec![max_num;(n-2) as usize]; + let mut bucket_max = vec![min_num;(n-2) as usize]; + for num in nums { + if num == min_num || num == max_num {continue} + let bucket_idx = (num - min_num) / bucket_gap; + let bucket_idx = bucket_idx as usize; + bucket_min[bucket_idx] = std::cmp::min(bucket_min[bucket_idx], num); + bucket_max[bucket_idx] = std::cmp::max(bucket_max[bucket_idx], num); + } + + let mut prev_max = min_num; + let mut max_gap = 0; + for i in 0..n-2 { + // empty bucket + let i = i as usize; + if bucket_min[i] == max_num && bucket_max[i] == min_num {continue} + max_gap = std::cmp::max(max_gap, bucket_min[i]-prev_max); + prev_max = bucket_max[i]; + } + std::cmp::max(max_gap, max_num - prev_max) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_164() { + assert_eq!(Solution::maximum_gap(vec![3, 6, 9, 1]), 3); + } +} diff --git a/src/problem/p0166_fraction_to_recurring_decimal.rs b/src/problem/p0166_fraction_to_recurring_decimal.rs new file mode 100644 index 00000000..08be93fb --- /dev/null +++ b/src/problem/p0166_fraction_to_recurring_decimal.rs @@ -0,0 +1,109 @@ +/** + * [166] Fraction to Recurring Decimal + * + * Given two integers representing the numerator and denominator of a fraction, return the fraction in string format. + * If the fractional part is repeating, enclose the repeating part in parentheses. + * If multiple answers are possible, return any of them. + * It is guaranteed that the length of the answer string is less than 10^4 for all the given inputs. + * + * Example 1: + * Input: numerator = 1, denominator = 2 + * Output: "0.5" + * Example 2: + * Input: numerator = 2, denominator = 1 + * Output: "2" + * Example 3: + * Input: numerator = 2, denominator = 3 + * Output: "0.(6)" + * Example 4: + * Input: numerator = 4, denominator = 333 + * Output: "0.(012)" + * Example 5: + * Input: numerator = 1, denominator = 5 + * Output: "0.2" + * + * Constraints: + * + * -2^31 <= numerator, denominator <= 2^31 - 1 + * denominator != 0 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/fraction-to-recurring-decimal/ +// discuss: https://leetcode.com/problems/fraction-to-recurring-decimal/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn fraction_to_decimal(numerator: i32, denominator: i32) -> String { + let numerator : i64 = numerator as i64; + let denominator : i64 = denominator as i64; + let mut neg : bool = (numerator * denominator) < 0; + let numerator = i64::abs(numerator); + let denominator = i64::abs(denominator); + + let int_part : i64 = numerator / denominator; + let mut frac_part : Vec = vec![]; + let mut repeated_pos : Option = None; + + let mut remainder : i64 = numerator % denominator; + let mut cache : HashMap = HashMap::new(); + while remainder != 0 { + cache.insert(remainder, frac_part.len()); + remainder *=10; + while remainder < denominator { + frac_part.push(0); + remainder *= 10; + } + frac_part.push(remainder / denominator); + remainder = remainder % denominator; + if let Some(&pos) = cache.get(&remainder) { + repeated_pos = Some(pos); + break; + } + } + let mut result : String = "".to_owned(); + if neg { + result.push('-'); + } + result.push_str(&int_part.to_string()); + if frac_part.len() == 0 { + // do nothing + } else if let Some(repeated_pos) = repeated_pos { + result.push('.'); + let no_repeated : String = frac_part[0..repeated_pos].iter(). + map(|&x|{(x as u8 + '0' as u8) as char}).collect(); + result.push_str(&no_repeated); + result.push('('); + let repeated : String = frac_part[repeated_pos..].iter() + .map(|&x|{(x as u8 + '0' as u8) as char}).collect(); + result.push_str(&repeated); + result.push(')'); + } else { + result.push('.'); + let no_repeated : String = frac_part[..].iter() + .map(|&x|{(x as u8 + '0' as u8) as char}).collect(); + result.push_str(&no_repeated); + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_166() { + // assert_eq!(Solution::fraction_to_decimal(1, 2), "0.5".to_owned()); + // assert_eq!(Solution::fraction_to_decimal(2, 1), "2".to_owned()); + // assert_eq!(Solution::fraction_to_decimal(2, 3), "0.(6)".to_owned()); + // assert_eq!(Solution::fraction_to_decimal(4, 333), "0.(012)".to_owned()); + // assert_eq!(Solution::fraction_to_decimal(1, 5), "0.2".to_owned()); + // assert_eq!(Solution::fraction_to_decimal(-50, 8), "-6.25".to_owned()); + assert_eq!(Solution::fraction_to_decimal(-1, -2147483648), "0.0000000004656612873077392578125".to_owned()); + } +} diff --git a/src/problem/p0169_majority_element.rs b/src/problem/p0169_majority_element.rs new file mode 100644 index 00000000..1b36c29f --- /dev/null +++ b/src/problem/p0169_majority_element.rs @@ -0,0 +1,59 @@ +/** + * [169] Majority Element + * + * Given an array nums of size n, return the majority element. + * The majority element is the element that appears more than ⌊n / 2⌋ times. You may assume that the majority element always exists in the array. + * + * Example 1: + * Input: nums = [3,2,3] + * Output: 3 + * Example 2: + * Input: nums = [2,2,1,1,1,2,2] + * Output: 2 + * + * Constraints: + * + * n == nums.length + * 1 <= n <= 5 * 10^4 + * -2^31 <= nums[i] <= 2^31 - 1 + * + * + * Follow-up: Could you solve the problem in linear time and in O(1) space? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/majority-element/ +// discuss: https://leetcode.com/problems/majority-element/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn majority_element(nums: Vec) -> i32 { + let mut mask = 1i32; + let mut result = 0; + for i in 0..32 { + let mut count = 0usize; + for &num in &nums { + if num & mask != 0 {count+=1} + } + // more than half of nums set i-th digit. + if count > nums.len() / 2 { + result |= mask; + } + mask <<= 1; + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_169() { + assert_eq!(Solution::majority_element(vec![2, 2, 1, 1, 1, 2, 2]), 2); + } +} diff --git a/src/problem/p0174_dungeon_game.rs b/src/problem/p0174_dungeon_game.rs new file mode 100644 index 00000000..c43ae813 --- /dev/null +++ b/src/problem/p0174_dungeon_game.rs @@ -0,0 +1,106 @@ +/** + * [174] Dungeon Game + * + * The demons had captured the princess and imprisoned her in the bottom-right corner of a dungeon. The dungeon consists of m x n rooms laid out in a 2D grid. Our valiant knight was initially positioned in the top-left room and must fight his way through dungeon to rescue the princess. + * The knight has an initial health point represented by a positive integer. If at any point his health point drops to 0 or below, he dies immediately. + * Some of the rooms are guarded by demons (represented by negative integers), so the knight loses health upon entering these rooms; other rooms are either empty (represented as 0) or contain magic orbs that increase the knight's health (represented by positive integers). + * To reach the princess as quickly as possible, the knight decides to move only rightward or downward in each step. + * Return the knight's minimum initial health so that he can rescue the princess. + * Note that any room can contain threats or power-ups, even the first room the knight enters and the bottom-right room where the princess is imprisoned. + * + * Example 1: + * + * Input: dungeon = [[-2,-3,3],[-5,-10,1],[10,30,-5]] + * Output: 7 + * Explanation: The initial health of the knight must be at least 7 if he follows the optimal path: RIGHT-> RIGHT -> DOWN -> DOWN. + * + * Example 2: + * + * Input: dungeon = [[0]] + * Output: 1 + * + * + * Constraints: + * + * m == dungeon.length + * n == dungeon[i].length + * 1 <= m, n <= 200 + * -1000 <= dungeon[i][j] <= 1000 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/dungeon-game/ +// discuss: https://leetcode.com/problems/dungeon-game/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn calculate_minimum_hp(dungeon: Vec>) -> i32 { + let row_count : usize = dungeon.len(); + let col_count : usize = dungeon[0].len(); + let mut result : Vec> = vec![vec![1i32;col_count]; row_count]; + for i in (0..row_count).rev() { + for j in (0..col_count).rev() { + let mut neighbor_min : Option = None; + if i < row_count - 1 { + neighbor_min = Some(result[i+1][j]); + } + if j < col_count - 1 { + if neighbor_min.is_none() || (neighbor_min.is_some() && result[i][j+1] < *neighbor_min.as_ref().unwrap()) { + neighbor_min = Some(result[i][j+1]); + } + } + + if dungeon[i][j] <= 0 { + if let Some(neighbor_min_hp) = neighbor_min { + result[i][j] = neighbor_min_hp - dungeon[i][j]; + } else { + result[i][j] = 1 - dungeon[i][j]; + } + } else { + + if let Some(neighbor_min_hp) = neighbor_min { + + if dungeon[i][j] >= neighbor_min_hp { + result[i][j] = 1; + } else { + result[i][j] = neighbor_min_hp - dungeon[i][j]; + } + + } else { + result[i][j] = 1; + } + + } + } + } + // for result in result.iter() { + // println!("{:?}", result); + // } + result[0][0] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_174() { + assert_eq!( + Solution::calculate_minimum_hp(vec![ + vec![-2, -3, 3], + vec![-5, -10, 1], + vec![10, 30, -5], + ]), + 7 + ); + assert_eq!( + Solution::calculate_minimum_hp(vec![vec![1, -4, 5, -99], vec![2, -2, -2, -1]]), + 3 + ); + } +} diff --git a/src/problem/p0179_largest_number.rs b/src/problem/p0179_largest_number.rs new file mode 100644 index 00000000..716d3588 --- /dev/null +++ b/src/problem/p0179_largest_number.rs @@ -0,0 +1,72 @@ +/** + * [179] Largest Number + * + * Given a list of non-negative integers nums, arrange them such that they form the largest number. + * Note: The result may be very large, so you need to return a string instead of an integer. + * + * Example 1: + * + * Input: nums = [10,2] + * Output: "210" + * + * Example 2: + * + * Input: nums = [3,30,34,5,9] + * Output: "9534330" + * + * Example 3: + * + * Input: nums = [1] + * Output: "1" + * + * Example 4: + * + * Input: nums = [10] + * Output: "10" + * + * + * Constraints: + * + * 1 <= nums.length <= 100 + * 0 <= nums[i] <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/largest-number/ +// discuss: https://leetcode.com/problems/largest-number/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn largest_number(mut nums: Vec) -> String { + nums.sort_by(|a,b| { + let ab : String = a.to_string() + b.to_string().as_str(); + let ba : String = b.to_string() + a.to_string().as_str(); + ab.cmp(&ba) + }); + let result : String = nums.iter().map(|x|{x.to_string()}).rev().collect(); + if let Some('0') = result.chars().nth(0) { + "0".to_owned() + } else { + result + } + // String::new() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_179() { + assert_eq!( + Solution::largest_number(vec![3, 30, 34, 5, 9]), + "9534330".to_owned() + ); + assert_eq!(Solution::largest_number(vec![121, 12]), "12121".to_owned()); + } +} diff --git a/src/problem/p0187_repeated_dna_sequences.rs b/src/problem/p0187_repeated_dna_sequences.rs new file mode 100644 index 00000000..064ea080 --- /dev/null +++ b/src/problem/p0187_repeated_dna_sequences.rs @@ -0,0 +1,78 @@ +/** + * [187] Repeated DNA Sequences + * + * The DNA sequence is composed of a series of nucleotides abbreviated as 'A', 'C', 'G', and 'T'. + * + * For example, "ACGAATTCCG" is a DNA sequence. + * + * When studying DNA, it is useful to identify repeated sequences within the DNA. + * Given a string s that represents a DNA sequence, return all the 10-letter-long sequences (substrings) that occur more than once in a DNA molecule. You may return the answer in any order. + * + * Example 1: + * Input: s = "AAAAACCCCCAAAAACCCCCCAAAAAGGGTTT" + * Output: ["AAAAACCCCC","CCCCCAAAAA"] + * Example 2: + * Input: s = "AAAAAAAAAAAAA" + * Output: ["AAAAAAAAAA"] + * + * Constraints: + * + * 1 <= s.length <= 10^5 + * s[i] is either 'A', 'C', 'G', or 'T'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/repeated-dna-sequences/ +// discuss: https://leetcode.com/problems/repeated-dna-sequences/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::{collections::HashSet}; + +impl Solution { + pub fn find_repeated_dna_sequences(s: String) -> Vec { + let mut dup = HashSet::new(); + let mut dup_result = vec![]; + if s.len() <= 10 { + return vec![] + } + + for i in 0..=s.len()-10 { + let sub = String::from(&s.as_str()[i..i+10]); + if dup.contains(&sub) { + // println!("substr={}, already exists...", sub); + dup_result.push(sub); + } else { + // println!("substr={}, not exists...", sub); + dup.insert(sub); + } + } + dup_result.sort(); + let mut result = vec![]; + for i in 0..dup_result.len() { + if i == 0 || dup_result[i-1] != dup_result[i] { + result.push(dup_result[i].clone()); + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_187() { + assert_eq!( + Solution::find_repeated_dna_sequences("AAAAACCCCCAAAAACCCCCCAAAAAGGGTTT".to_owned()), + vec_string!["AAAAACCCCC", "CCCCCAAAAA"] + ); + assert_eq!( + Solution::find_repeated_dna_sequences("GAGAGAGAGAGA".to_owned()), + vec_string!["GAGAGAGAGA"] + ); + } +} diff --git a/src/problem/p0188_best_time_to_buy_and_sell_stock_iv.rs b/src/problem/p0188_best_time_to_buy_and_sell_stock_iv.rs new file mode 100644 index 00000000..f0ee5e0b --- /dev/null +++ b/src/problem/p0188_best_time_to_buy_and_sell_stock_iv.rs @@ -0,0 +1,118 @@ +/** + * [188] Best Time to Buy and Sell Stock IV + * + * You are given an integer array prices where prices[i] is the price of a given stock on the i^th day, and an integer k. + * Find the maximum profit you can achieve. You may complete at most k transactions. + * Note: You may not engage in multiple transactions simultaneously (i.e., you must sell the stock before you buy again). + * + * Example 1: + * + * Input: k = 2, prices = [2,4,1] + * Output: 2 + * Explanation: Buy on day 1 (price = 2) and sell on day 2 (price = 4), profit = 4-2 = 2. + * + * Example 2: + * + * Input: k = 2, prices = [3,2,6,5,0,3] + * Output: 7 + * Explanation: Buy on day 2 (price = 2) and sell on day 3 (price = 6), profit = 6-2 = 4. Then buy on day 5 (price = 0) and sell on day 6 (price = 3), profit = 3-0 = 3. + * + * + * Constraints: + * + * 0 <= k <= 100 + * 0 <= prices.length <= 1000 + * 0 <= prices[i] <= 1000 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/best-time-to-buy-and-sell-stock-iv/ +// discuss: https://leetcode.com/problems/best-time-to-buy-and-sell-stock-iv/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn max_profit(k: i32, prices: Vec) -> i32 { + // Since a txn must span at least two days, one day to buy and one day to sell, when k >n/2, it is equivalent to k = inf. + // We skip this optimization for clarity. + + let k = k as usize; + let mut last_no_stock_balances : Vec = vec![0;k+1]; + let min_i32 = -2_147_483_648i32; + let mut last_with_stock_balances : Vec = vec![min_i32;k+1]; + for price in prices.iter() { + // iterate reversely so that last_no_stock_balances[k-1] = no_stock_balances[i-1][k-1]. If not reverse, it would be last_no_stock_balances[k-1] = no_stock_balances[i][k-1] + for kk in (1..=k).rev() { + last_no_stock_balances[kk] = std::cmp::max(last_no_stock_balances[kk], last_with_stock_balances[kk] + price); + + last_with_stock_balances[kk] = std::cmp::max(last_with_stock_balances[kk], last_no_stock_balances[kk-1] - price); + } + } + last_no_stock_balances[k] + } + + pub fn max_profit1(k: i32, prices: Vec) -> i32 { + let k = k as usize; + let n = prices.len(); + let mut balances : Vec> = vec![vec![0;n];k+1]; + for i_k in 1..=k { + let mut min : i32 = prices[0]; + for j_n in 1..n { + min = std::cmp::min(min, prices[j_n]-balances[i_k-1][j_n-1]); + balances[i_k][j_n] = std::cmp::max(balances[i_k][j_n-1], prices[j_n]-min); + } + } + balances[k][n-1] + } + + pub fn my_max_profit(k: i32, prices: Vec) -> i32 { + let k = k as usize; + let i32_min = -2_147_483_648i32; + // on_hold[i] represents the asset after the i-th buying + let mut on_hold : Vec = vec![i32_min;k+1]; + // no_hold[i] represents the asset after the i-th selling + let mut no_hold : Vec = vec![i32_min;k+1]; + no_hold[0] = 0; + + for (i, &price) in prices.iter().enumerate() { + let mut cur_on_hold : Vec = on_hold.clone(); + let mut cur_no_hold : Vec = no_hold.clone(); + let max_buy_times = k; + for j in 1..=max_buy_times { + if no_hold[j-1] == i32_min { + // otherwise, no_hold[j-1] - price will overflow. + cur_on_hold[j] = on_hold[j]; + } else { + cur_on_hold[j] = std::cmp::max(on_hold[j], no_hold[j-1] - price); + } + } + let max_sell_times = k; + for j in 1..=max_sell_times { + if on_hold[j] == i32_min { + cur_no_hold[j] = no_hold[j]; + } else { + cur_no_hold[j] = std::cmp::max(no_hold[j], on_hold[j] + price); + } + } + + on_hold = cur_on_hold; + no_hold = cur_no_hold; + } + *no_hold.iter().max().unwrap() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_188() { + assert_eq!(Solution::max_profit(2, vec![2,4,1]), 2); + assert_eq!(Solution::max_profit(2, vec![3, 2, 6, 5, 0, 3]), 7); + assert_eq!(Solution::max_profit(4, vec![1,2,4,2,5,7,2,4,9,0]), 15); + } +} diff --git a/src/problem/p0189_rotate_array.rs b/src/problem/p0189_rotate_array.rs new file mode 100644 index 00000000..f09169e1 --- /dev/null +++ b/src/problem/p0189_rotate_array.rs @@ -0,0 +1,76 @@ +/** + * [189] Rotate Array + * + * Given an array, rotate the array to the right by k steps, where k is non-negative. + * + * Example 1: + * + * Input: nums = [1,2,3,4,5,6,7], k = 3 + * Output: [5,6,7,1,2,3,4] + * Explanation: + * rotate 1 steps to the right: [7,1,2,3,4,5,6] + * rotate 2 steps to the right: [6,7,1,2,3,4,5] + * rotate 3 steps to the right: [5,6,7,1,2,3,4] + * + * Example 2: + * + * Input: nums = [-1,-100,3,99], k = 2 + * Output: [3,99,-1,-100] + * Explanation: + * rotate 1 steps to the right: [99,-1,-100,3] + * rotate 2 steps to the right: [3,99,-1,-100] + * + * + * Constraints: + * + * 1 <= nums.length <= 10^5 + * -2^31 <= nums[i] <= 2^31 - 1 + * 0 <= k <= 10^5 + * + * + * Follow up: + * + * Try to come up with as many solutions as you can. There are at least three different ways to solve this problem. + * Could you do it in-place with O(1) extra space? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/rotate-array/ +// discuss: https://leetcode.com/problems/rotate-array/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + // start inclusive, end exclusive + pub fn reverse(nums: &mut Vec, start : usize, end : usize) { + let mid = (end - start) / 2; + for i in 0..mid { + nums.swap(start + i, end - 1 - i); + } + } + + pub fn rotate(nums: &mut Vec, k: i32) { + let k : usize = k as usize % nums.len(); + Self::reverse(nums, 0, nums.len()); + Self::reverse(nums, 0, k); + Self::reverse(nums, k, nums.len()); + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_189() { + let mut nums = vec![1, 2, 3, 4, 5, 6, 7]; + Solution::rotate(&mut nums, 3); + assert_eq!(nums, vec![5, 6, 7, 1, 2, 3, 4]); + let mut nums = vec![1, 2, 3, 4, 5, 6]; + Solution::rotate(&mut nums, 2); + assert_eq!(nums, vec![5, 6, 1, 2, 3, 4]); + } +} diff --git a/src/problem/p0190_reverse_bits.rs b/src/problem/p0190_reverse_bits.rs new file mode 100644 index 00000000..f704da39 --- /dev/null +++ b/src/problem/p0190_reverse_bits.rs @@ -0,0 +1,60 @@ +/** + * [190] Reverse Bits + * + * Reverse bits of a given 32 bits unsigned integer. + * Note: + * + * Note that in some languages such as Java, there is no unsigned integer type. In this case, both input and output will be given as a signed integer type. They should not affect your implementation, as the integer's internal binary representation is the same, whether it is signed or unsigned. + * In Java, the compiler represents the signed integers using 2's complement notation. Therefore, in Example 2 above, the input represents the signed integer -3 and the output represents the signed integer -1073741825. + * + * Follow up: + * If this function is called many times, how would you optimize it? + * + * Example 1: + * + * Input: n = 00000010100101000001111010011100 + * Output: 964176192 (00111001011110000010100101000000) + * Explanation: The input binary string 00000010100101000001111010011100 represents the unsigned integer 43261596, so return 964176192 which its binary representation is 00111001011110000010100101000000. + * + * Example 2: + * + * Input: n = 11111111111111111111111111111101 + * Output: 3221225471 (10111111111111111111111111111111) + * Explanation: The input binary string 11111111111111111111111111111101 represents the unsigned integer 4294967293, so return 3221225471 which its binary representation is 10111111111111111111111111111111. + * + * + * Constraints: + * + * The input must be a binary string of length 32 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/reverse-bits/ +// discuss: https://leetcode.com/problems/reverse-bits/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn reverse_bits(x: u32) -> u32 { + let mut result : u32 = 0; + for i in 0..32 { + if x & (1 << i) != 0 { + result |= 1 << (32 - 1 - i); + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_190() { + assert_eq!(Solution::reverse_bits(43261596), 964176192); + } +} diff --git a/src/problem/p0191_number_of_1_bits.rs b/src/problem/p0191_number_of_1_bits.rs new file mode 100644 index 00000000..28337dff --- /dev/null +++ b/src/problem/p0191_number_of_1_bits.rs @@ -0,0 +1,64 @@ +/** + * [191] Number of 1 Bits + * + * Write a function that takes an unsigned integer and returns the number of '1' bits it has (also known as the Hamming weight). + * Note: + * + * Note that in some languages, such as Java, there is no unsigned integer type. In this case, the input will be given as a signed integer type. It should not affect your implementation, as the integer's internal binary representation is the same, whether it is signed or unsigned. + * In Java, the compiler represents the signed integers using 2's complement notation. Therefore, in Example 3, the input represents the signed integer. -3. + * + * + * Example 1: + * + * Input: n = 00000000000000000000000000001011 + * Output: 3 + * Explanation: The input binary string 00000000000000000000000000001011 has a total of three '1' bits. + * + * Example 2: + * + * Input: n = 00000000000000000000000010000000 + * Output: 1 + * Explanation: The input binary string 00000000000000000000000010000000 has a total of one '1' bit. + * + * Example 3: + * + * Input: n = 11111111111111111111111111111101 + * Output: 31 + * Explanation: The input binary string 11111111111111111111111111111101 has a total of thirty one '1' bits. + * + * + * Constraints: + * + * The input must be a binary string of length 32. + * + * + * Follow up: If this function is called many times, how would you optimize it? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/number-of-1-bits/ +// discuss: https://leetcode.com/problems/number-of-1-bits/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn hamming_weight (mut n: u32) -> i32 { + let mut count : i32 = 0; + while n != 0 { + n = n & (n-1); + count += 1; + } + count + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_191() { + } +} diff --git a/src/problem/p0198_house_robber.rs b/src/problem/p0198_house_robber.rs new file mode 100644 index 00000000..22241376 --- /dev/null +++ b/src/problem/p0198_house_robber.rs @@ -0,0 +1,62 @@ +/** + * [198] House Robber + * + * You are a professional robber planning to rob houses along a street. Each house has a certain amount of money stashed, the only constraint stopping you from robbing each of them is that adjacent houses have security systems connected and it will automatically contact the police if two adjacent houses were broken into on the same night. + * Given an integer array nums representing the amount of money of each house, return the maximum amount of money you can rob tonight without alerting the police. + * + * Example 1: + * + * Input: nums = [1,2,3,1] + * Output: 4 + * Explanation: Rob house 1 (money = 1) and then rob house 3 (money = 3). + * Total amount you can rob = 1 + 3 = 4. + * + * Example 2: + * + * Input: nums = [2,7,9,3,1] + * Output: 12 + * Explanation: Rob house 1 (money = 2), rob house 3 (money = 9) and rob house 5 (money = 1). + * Total amount you can rob = 2 + 9 + 1 = 12. + * + * + * Constraints: + * + * 1 <= nums.length <= 100 + * 0 <= nums[i] <= 400 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/house-robber/ +// discuss: https://leetcode.com/problems/house-robber/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn rob(nums: Vec) -> i32 { + let mut prev_robbed_amount : i32 = 0; + let mut prev_unrobbed_amount : i32 = 0; + for &num in nums.iter() { + let last_prev_robbed_amount = prev_robbed_amount; + let last_prev_unrobbed_amount = prev_unrobbed_amount; + + prev_robbed_amount = last_prev_unrobbed_amount + num; + prev_unrobbed_amount = std::cmp::max(last_prev_unrobbed_amount, last_prev_robbed_amount); + } + std::cmp::max(prev_robbed_amount, prev_unrobbed_amount) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_198() { + assert_eq!(Solution::rob(vec![2, 7, 9, 3, 1]), 12); + assert_eq!(Solution::rob(vec![2, 7, 9, 10, 1]), 17); + assert_eq!(Solution::rob(vec![2, 1, 1, 2]), 4); + } +} diff --git a/src/problem/p0199_binary_tree_right_side_view.rs b/src/problem/p0199_binary_tree_right_side_view.rs new file mode 100644 index 00000000..8e1d36b6 --- /dev/null +++ b/src/problem/p0199_binary_tree_right_side_view.rs @@ -0,0 +1,106 @@ +/** + * [199] Binary Tree Right Side View + * + * Given the root of a binary tree, imagine yourself standing on the right side of it, return the values of the nodes you can see ordered from top to bottom. + * + * Example 1: + * + * Input: root = [1,2,3,null,5,null,4] + * Output: [1,3,4] + * + * Example 2: + * + * Input: root = [1,null,3] + * Output: [1,3] + * + * Example 3: + * + * Input: root = [] + * Output: [] + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 100]. + * -100 <= Node.val <= 100 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/binary-tree-right-side-view/ +// discuss: https://leetcode.com/problems/binary-tree-right-side-view/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::{borrow::Borrow, rc::Rc}; +use std::cell::RefCell; +struct NodeInfo(Rc>, usize); +use std::collections::VecDeque; + +impl Solution { + pub fn right_side_view(root: Option>>) -> Vec { + let mut result =vec![]; + if root.is_none() {return result} + + let mut last_level = 0usize; + let mut last_node : Rc> = Rc::clone(root.as_ref().unwrap()); + + let mut queue: VecDeque = VecDeque::new(); + queue.push_back(NodeInfo(root.unwrap(), 1usize)); + + while let Some(node_info) = queue.pop_front() { + let NodeInfo(node, level) = node_info; + // println!("last_level = {}, level = {}, node val = {}", last_level, level, (*node).borrow().val); + if last_level != 0 && last_level < level { + result.push((*last_node).borrow().val); + } + + if let Some(left_node) = node.borrow_mut().left.take() { + queue.push_back(NodeInfo(left_node, level+1)); + }; + + if let Some(right_node) = node.borrow_mut().right.take() { + queue.push_back(NodeInfo(right_node, level+1)); + }; + last_level = level; // traversed to a deeper level. + last_node = Rc::clone(&node); + } + result.push((*last_node).borrow().val); + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_199() { + assert_eq!( + Solution::right_side_view(tree![1, 2, 3, null, 5, null, 4]), + vec![1, 3, 4] + ); + } +} diff --git a/src/problem/p0200_number_of_islands.rs b/src/problem/p0200_number_of_islands.rs new file mode 100644 index 00000000..e6217e68 --- /dev/null +++ b/src/problem/p0200_number_of_islands.rs @@ -0,0 +1,97 @@ +/** + * [200] Number of Islands + * + * Given an m x n 2D binary grid grid which represents a map of '1's (land) and '0's (water), return the number of islands. + * An island is surrounded by water and is formed by connecting adjacent lands horizontally or vertically. You may assume all four edges of the grid are all surrounded by water. + * + * Example 1: + * + * Input: grid = [ + * ["1","1","1","1","0"], + * ["1","1","0","1","0"], + * ["1","1","0","0","0"], + * ["0","0","0","0","0"] + * ] + * Output: 1 + * + * Example 2: + * + * Input: grid = [ + * ["1","1","0","0","0"], + * ["1","1","0","0","0"], + * ["0","0","1","0","0"], + * ["0","0","0","1","1"] + * ] + * Output: 3 + * + * + * Constraints: + * + * m == grid.length + * n == grid[i].length + * 1 <= m, n <= 300 + * grid[i][j] is '0' or '1'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/number-of-islands/ +// discuss: https://leetcode.com/problems/number-of-islands/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn traverse_set_zero(grid : &mut Vec>, i : i32, j : i32) { + if 0 <= i && i < grid.len() as i32 && 0 <= j && j < grid[0].len() as i32 && grid[i as usize][j as usize] == '1' { + grid[i as usize][j as usize] = '0'; + Self::traverse_set_zero(grid, i+1, j); + Self::traverse_set_zero(grid, i-1, j); + Self::traverse_set_zero(grid, i, j+1); + Self::traverse_set_zero(grid, i, j-1); + } + } + + pub fn num_islands(mut grid: Vec>) -> i32 { + let row_count : usize = grid.len(); + let col_count : usize = grid[0].len(); + let mut count : i32 = 0; + for i in 0..row_count { + for j in 0..col_count { + if grid[i][j] == '1' { + Self::traverse_set_zero(&mut grid, i as i32, j as i32); + count += 1; + } + } + } + count + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_200() { + assert_eq!( + Solution::num_islands(vec![ + vec!['1', '1', '1', '1', '0',], + vec!['1', '1', '0', '1', '0',], + vec!['1', '1', '0', '0', '0',], + vec!['0', '0', '0', '0', '0',], + ]), + 1 + ); + assert_eq!( + Solution::num_islands(vec![ + vec!['1', '1', 'o', '1', '0',], + vec!['1', '1', '0', '1', '0',], + vec!['1', '1', '0', '0', '0',], + vec!['0', '0', '0', '1', '1',], + ]), + 3 + ); + } +} diff --git a/src/problem/p0201_bitwise_and_of_numbers_range.rs b/src/problem/p0201_bitwise_and_of_numbers_range.rs new file mode 100644 index 00000000..ee7d1043 --- /dev/null +++ b/src/problem/p0201_bitwise_and_of_numbers_range.rs @@ -0,0 +1,64 @@ +/** + * [201] Bitwise AND of Numbers Range + * + * Given two integers left and right that represent the range [left, right], return the bitwise AND of all numbers in this range, inclusive. + * + * Example 1: + * + * Input: left = 5, right = 7 + * Output: 4 + * + * Example 2: + * + * Input: left = 0, right = 0 + * Output: 0 + * + * Example 3: + * + * Input: left = 1, right = 2147483647 + * Output: 0 + * + * + * Constraints: + * + * 0 <= left <= right <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/bitwise-and-of-numbers-range/ +// discuss: https://leetcode.com/problems/bitwise-and-of-numbers-range/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn range_bitwise_and(mut left: i32, mut right: i32) -> i32 { + let mut result = 0; + if left != 0 { + let mut bit = 0usize; + while left != right { + // println!("left={}, right={}, result={}, bit={}", left, right, result, bit); + // result |= 1 << bit; + bit += 1; + left >>= 1; + right >>= 1; + } + // println!("left={}, right={}, result={}, bit={}", left, right, result, bit); + left * (1 << bit) + } else { + 0 + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_201() { + assert_eq!(Solution::range_bitwise_and(5, 7), 4); + } +} diff --git a/src/problem/p0203_remove_linked_list_elements.rs b/src/problem/p0203_remove_linked_list_elements.rs new file mode 100644 index 00000000..4efc1b9b --- /dev/null +++ b/src/problem/p0203_remove_linked_list_elements.rs @@ -0,0 +1,79 @@ +/** + * [203] Remove Linked List Elements + * + * Given the head of a linked list and an integer val, remove all the nodes of the linked list that has Node.val == val, and return the new head. + * + * Example 1: + * + * Input: head = [1,2,6,3,4,5,6], val = 6 + * Output: [1,2,3,4,5] + * + * Example 2: + * + * Input: head = [], val = 1 + * Output: [] + * + * Example 3: + * + * Input: head = [7,7,7,7], val = 7 + * Output: [] + * + * + * Constraints: + * + * The number of nodes in the list is in the range [0, 10^4]. + * 1 <= Node.val <= 50 + * 0 <= k <= 50 + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/remove-linked-list-elements/ +// discuss: https://leetcode.com/problems/remove-linked-list-elements/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn remove_elements(mut head: Option>, val: i32) -> Option> { + if head.is_none() { + None + } else if head.as_ref().unwrap().val == val { + Self::remove_elements(head.as_mut().unwrap().next.take(), val) + } else { + head.as_mut().unwrap().next = Self::remove_elements(head.as_mut().unwrap().next.take(), val); + head + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_203() { + assert_eq!( + Solution::remove_elements(linked![1, 2, 6, 3, 4, 5, 6], 6), + linked![1, 2, 3, 4, 5] + ); + } +} diff --git a/src/problem/p0206_reverse_linked_list.rs b/src/problem/p0206_reverse_linked_list.rs new file mode 100644 index 00000000..c04b37d6 --- /dev/null +++ b/src/problem/p0206_reverse_linked_list.rs @@ -0,0 +1,83 @@ +/** + * [206] Reverse Linked List + * + * Given the head of a singly linked list, reverse the list, and return the reversed list. + * + * Example 1: + * + * Input: head = [1,2,3,4,5] + * Output: [5,4,3,2,1] + * + * Example 2: + * + * Input: head = [1,2] + * Output: [2,1] + * + * Example 3: + * + * Input: head = [] + * Output: [] + * + * + * Constraints: + * + * The number of nodes in the list is the range [0, 5000]. + * -5000 <= Node.val <= 5000 + * + * + * Follow up: A linked list can be reversed either iteratively or recursively. Could you implement both? + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/reverse-linked-list/ +// discuss: https://leetcode.com/problems/reverse-linked-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn reverse_list(head: Option>) -> Option> { + + let mut reversed = None; + let mut unreversed = head; + while let Some(mut unreversed_node) = unreversed { + unreversed = unreversed_node.next; + unreversed_node.next = reversed; + reversed = Some(unreversed_node); + } + + reversed + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_206() { + assert_eq!( + Solution::reverse_list(linked![1, 2, 3, 4, 5]), + linked![5, 4, 3, 2, 1] + ); + } +} diff --git a/src/problem/p0207_course_schedule.rs b/src/problem/p0207_course_schedule.rs new file mode 100644 index 00000000..a0fd0613 --- /dev/null +++ b/src/problem/p0207_course_schedule.rs @@ -0,0 +1,120 @@ +use std::collections::{HashMap, HashSet}; + +/** + * [207] Course Schedule + * + * There are a total of numCourses courses you have to take, labeled from 0 to numCourses - 1. You are given an array prerequisites where prerequisites[i] = [ai, bi] indicates that you must take course bi first if you want to take course ai. + * + * For example, the pair [0, 1], indicates that to take course 0 you have to first take course 1. + * + * Return true if you can finish all courses. Otherwise, return false. + * + * Example 1: + * + * Input: numCourses = 2, prerequisites = [[1,0]] + * Output: true + * Explanation: There are a total of 2 courses to take. + * To take course 1 you should have finished course 0. So it is possible. + * + * Example 2: + * + * Input: numCourses = 2, prerequisites = [[1,0],[0,1]] + * Output: false + * Explanation: There are a total of 2 courses to take. + * To take course 1 you should have finished course 0, and to take course 0 you should also have finished course 1. So it is impossible. + * + * + * Constraints: + * + * 1 <= numCourses <= 10^5 + * 0 <= prerequisites.length <= 5000 + * prerequisites[i].length == 2 + * 0 <= ai, bi < numCourses + * All the pairs prerequisites[i] are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/course-schedule/ +// discuss: https://leetcode.com/problems/course-schedule/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +#[derive(Clone, Debug)] +struct NodeInfo{in_degree: usize, out_nodes: Vec} + +impl Solution { + pub fn can_finish(num_courses: i32, prerequisites: Vec>) -> bool { + let mut graph = vec![NodeInfo{in_degree: 0, out_nodes: vec![]}; num_courses as usize]; + for dep in prerequisites { + let in_node = dep[0]; + let out_node = dep[1]; + graph[out_node as usize].in_degree += 1; + graph[in_node as usize].out_nodes.push(out_node); + } + + // repeatively loop graph until either happens + // * all node.in == -1, return true + // * some -1, some > 1 but no 0, return false + let mut processed = HashSet::new(); + let mut found_root = true; + while found_root { + let mut decre_out_nodes = vec![]; + for (node_idx, node_info) in graph.iter_mut().enumerate() { + let node_idx = node_idx as i32; + if processed.contains(&node_idx) { + continue; + } + + if node_info.in_degree == 0 { + processed.insert(node_idx as i32); + if 0 < node_info.out_nodes.len() { + decre_out_nodes = node_info.out_nodes.clone(); + // println!("Found root for {}", node_idx); + break; + } + } + } + + found_root = false; + for out_node in decre_out_nodes { + if processed.contains(&out_node) { + panic!("Shall not process {} before", &out_node); + } + if graph[out_node as usize].in_degree <= 0 { + panic!("Shall not get non-positive indegree for {}", out_node); + } + found_root = true; + graph[out_node as usize].in_degree -= 1; + } + } + + return processed.len() == num_courses as usize; + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_207() { + assert_eq!(Solution::can_finish(2, vec![vec![1, 0]]), true); + assert_eq!(Solution::can_finish(2, vec![vec![1, 0], vec![0, 1]]), false); + assert_eq!( + Solution::can_finish( + 8, + vec![ + vec![1, 0], + vec![2, 6], + vec![1, 7], + vec![6, 4], + vec![7, 0], + vec![0, 5] + ] + ), + true + ); + } +} diff --git a/src/problem/p0208_implement_trie_prefix_tree.rs b/src/problem/p0208_implement_trie_prefix_tree.rs new file mode 100644 index 00000000..49edbfc2 --- /dev/null +++ b/src/problem/p0208_implement_trie_prefix_tree.rs @@ -0,0 +1,139 @@ +/** + * [208] Implement Trie (Prefix Tree) + * + * A trie (pronounced as "try") or prefix tree is a tree data structure used to efficiently store and retrieve keys in a dataset of strings. There are various applications of this data structure, such as autocomplete and spellchecker. + * Implement the Trie class: + * + * Trie() Initializes the trie object. + * void insert(String word) Inserts the string word into the trie. + * boolean search(String word) Returns true if the string word is in the trie (i.e., was inserted before), and false otherwise. + * boolean startsWith(String prefix) Returns true if there is a previously inserted string word that has the prefix prefix, and false otherwise. + * + * + * Example 1: + * + * Input + * ["Trie", "insert", "search", "search", "startsWith", "insert", "search"] + * [[], ["apple"], ["apple"], ["app"], ["app"], ["app"], ["app"]] + * Output + * [null, null, true, false, true, null, true] + * Explanation + * Trie trie = new Trie(); + * trie.insert("apple"); + * trie.search("apple"); // return True + * trie.search("app"); // return False + * trie.startsWith("app"); // return True + * trie.insert("app"); + * trie.search("app"); // return True + * + * + * Constraints: + * + * 1 <= word.length, prefix.length <= 2000 + * word and prefix consist only of lowercase English letters. + * At most 3 * 10^4 calls in total will be made to insert, search, and startsWith. + * + */ +pub struct Solution {} + + +// problem: https://leetcode.com/problems/implement-trie-prefix-tree/ +// discuss: https://leetcode.com/problems/implement-trie-prefix-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + + +struct Node { + branches: Vec>>, + exists: bool +} + +struct Trie { + root: Node, +} + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl Trie { + + /** Initialize your data structure here. */ + fn new() -> Self { + Trie{root:Node{branches: (0..26).map(|x|{None}).collect(), exists: false}} + } + + /** Inserts a word into the trie. */ + fn insert(&mut self, word: String) { + let chars : Vec = word.chars().collect(); + let mut node : &mut Node = &mut self.root; + for i in 0..chars.len() { + let char_pos = (chars[i] as u8 - 'a' as u8) as usize; + if node.branches[char_pos].is_none() { + node.branches[char_pos] = Some(Box::new(Node{branches: (0..26).map(|x|{None}).collect(), exists: false})); + } + node = node.branches[char_pos].as_mut().unwrap(); + } + node.exists = true; + } + + + /** Returns if the word is in the trie. */ + fn search(&self, word: String) -> bool { + let mut node : &Node = &self.root; + let chars : Vec = word.chars().collect(); + for i in 0..chars.len() { + let char_pos = (chars[i] as u8 - 'a' as u8) as usize; + if node.branches[char_pos].is_none() { + return false; + } + node = node.branches[char_pos].as_ref().unwrap(); + } + node.exists + } + + /** Returns if there is any word in the trie that starts with the given prefix. */ + fn starts_with(&self, prefix: String) -> bool { + let mut node : &Node = &self.root; + let chars : Vec = prefix.chars().collect(); + for i in 0..chars.len() { + let char_pos = (chars[i] as u8 - 'a' as u8) as usize; + if node.branches[char_pos].is_none() { + return false; + } + node = node.branches[char_pos].as_ref().unwrap(); + } + node.exists || node.branches.iter().any(|x|{x.is_some()}) + } +} + +/** + * Your Trie object will be instantiated and called as such: + * let obj = Trie::new(); + * obj.insert(word); + * let ret_2: bool = obj.search(word); + * let ret_3: bool = obj.starts_with(prefix); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_208() { + let mut box_int : Box = Box::new(1i32); + let int_ref :&i32 = &box_int; + println!("*box_int={}, box_int={}, &box_int={}", *box_int, box_int, &box_int); + + + let mut trie = Trie::new(); + trie.insert("apple".to_owned()); + assert_eq!(trie.search("apple".to_owned()), true); // returns true + assert_eq!(trie.search("app".to_owned()), false); + assert_eq!(trie.starts_with("app".to_owned()), true); // returns true + trie.insert("app".to_owned()); + assert_eq!(trie.search("app".to_owned()), true); // returns true + } +} diff --git a/src/problem/p0209_minimum_size_subarray_sum.rs b/src/problem/p0209_minimum_size_subarray_sum.rs new file mode 100644 index 00000000..8a7162fc --- /dev/null +++ b/src/problem/p0209_minimum_size_subarray_sum.rs @@ -0,0 +1,83 @@ +/** + * [209] Minimum Size Subarray Sum + * + * Given an array of positive integers nums and a positive integer target, return the minimal length of a contiguous subarray [numsl, numsl+1, ..., numsr-1, numsr] of which the sum is greater than or equal to target. If there is no such subarray, return 0 instead. + * + * Example 1: + * + * Input: target = 7, nums = [2,3,1,2,4,3] + * Output: 2 + * Explanation: The subarray [4,3] has the minimal length under the problem constraint. + * + * Example 2: + * + * Input: target = 4, nums = [1,4,4] + * Output: 1 + * + * Example 3: + * + * Input: target = 11, nums = [1,1,1,1,1,1,1,1] + * Output: 0 + * + * + * Constraints: + * + * 1 <= target <= 10^9 + * 1 <= nums.length <= 10^5 + * 1 <= nums[i] <= 10^5 + * + * + * Follow up: If you have figured out the O(n) solution, try coding another solution of which the time complexity is O(n log(n)). + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/minimum-size-subarray-sum/ +// discuss: https://leetcode.com/problems/minimum-size-subarray-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn min_sub_array_len(target: i32, nums: Vec) -> i32 { + let (mut left, mut right) = (0, 0); + let mut sum = nums[0]; + let mut min_length = nums.len(); + let mut found = false; + loop { + println!("left = {}, right = {}, sum = {}, target = {}", left, right, sum, target); + if sum < target { + right += 1; + if right == nums.len() { + break; + } + sum += nums[right]; + } else { + if left == right { + return 1; + } else if right - left + 1 <= min_length { + min_length = right - left + 1; + found = true; + } + sum -= nums[left]; + left += 1; + } + } + if found { + return min_length as i32; + } else { + return 0; + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_209() { + assert_eq!(Solution::min_sub_array_len(7, vec![2, 3, 1, 2, 4, 3]), 2); + assert_eq!(Solution::min_sub_array_len(4, vec![1, 4, 4]), 1); + } +} diff --git a/src/problem/p0210_course_schedule_ii.rs b/src/problem/p0210_course_schedule_ii.rs new file mode 100644 index 00000000..4e4e5f91 --- /dev/null +++ b/src/problem/p0210_course_schedule_ii.rs @@ -0,0 +1,118 @@ +/** + * [210] Course Schedule II + * + * There are a total of numCourses courses you have to take, labeled from 0 to numCourses - 1. You are given an array prerequisites where prerequisites[i] = [ai, bi] indicates that you must take course bi first if you want to take course ai. + * + * For example, the pair [0, 1], indicates that to take course 0 you have to first take course 1. + * + * Return the ordering of courses you should take to finish all courses. If there are many valid answers, return any of them. If it is impossible to finish all courses, return an empty array. + * + * Example 1: + * + * Input: numCourses = 2, prerequisites = [[1,0]] + * Output: [0,1] + * Explanation: There are a total of 2 courses to take. To take course 1 you should have finished course 0. So the correct course order is [0,1]. + * + * Example 2: + * + * Input: numCourses = 4, prerequisites = [[1,0],[2,0],[3,1],[3,2]] + * Output: [0,2,1,3] + * Explanation: There are a total of 4 courses to take. To take course 3 you should have finished both courses 1 and 2. Both courses 1 and 2 should be taken after you finished course 0. + * So one correct course order is [0,1,2,3]. Another correct ordering is [0,2,1,3]. + * + * Example 3: + * + * Input: numCourses = 1, prerequisites = [] + * Output: [0] + * + * + * Constraints: + * + * 1 <= numCourses <= 2000 + * 0 <= prerequisites.length <= numCourses * (numCourses - 1) + * prerequisites[i].length == 2 + * 0 <= ai, bi < numCourses + * ai != bi + * All the pairs [ai, bi] are distinct. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/course-schedule-ii/ +// discuss: https://leetcode.com/problems/course-schedule-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::BTreeMap; +use std::collections::HashSet; +use std::collections::HashMap; +impl Solution { + pub fn find_order(num_courses: i32, prerequisites: Vec>) -> Vec { + let mut pred : HashMap> = HashMap::new(); + let mut succ : HashMap> = HashMap::new(); + for i in 0..(num_courses as usize) { + pred.insert(i, HashSet::new()); + succ.insert(i, HashSet::new()); + } + + + for prerequisite in prerequisites.iter() { + let s : usize = prerequisite[0] as usize; + let p : usize = prerequisite[1] as usize; + pred.get_mut(&s).unwrap().insert(p); + succ.get_mut(&p).unwrap().insert(s); + } + + // key: # of predecessor, value: course id with that # of predecessor + let mut pred_counts : BTreeMap> = BTreeMap::new(); + for (&cid, preds) in pred.iter() { + pred_counts.entry(preds.len()).or_insert(HashSet::new()).insert(cid); + } + // println!("pred={:?}", pred); + // println!("succ={:?}\n", succ); + // println!("pred_counts={:?}", pred_counts); + + let mut result : Vec = vec![]; + while pred_counts.len() > 0 { + // println!("pred_counts: {:?}", pred_counts); + let (&smallest_pred_count, cids) = pred_counts.iter_mut().next().unwrap(); + // println!("smallest_pred_count: {:?}", smallest_pred_count); + if smallest_pred_count != 0 { return vec![]; } + let cid : usize = *cids.iter().next().unwrap(); + cids.remove(&cid); + if cids.len() == 0 { + pred_counts.remove(&smallest_pred_count); + } + + result.push(cid as i32); + + // println!("cid={}", cid); + for &succ_cid in succ[&cid].iter() { + // println!("\tsucc_cid={}", succ_cid); + let cur_pred_count : usize = pred[&succ_cid].len(); + pred_counts.get_mut(&cur_pred_count).unwrap().remove(&succ_cid); + if pred_counts[&cur_pred_count].len() == 0 { + pred_counts.remove(&cur_pred_count); + } + pred_counts.entry(cur_pred_count - 1).or_insert(HashSet::new()).insert(succ_cid); + pred.get_mut(&succ_cid).unwrap().remove(&cid); + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_210() { + assert_eq!(Solution::find_order(2, vec![vec![1, 0]]), vec![0, 1]); + assert_eq!( + Solution::find_order(4, vec![vec![1, 0], vec![2, 0], vec![3, 1], vec![3, 2]]), + vec![0, 1, 2, 3] + ); + } +} diff --git a/src/problem/p0211_design_add_and_search_words_data_structure.rs b/src/problem/p0211_design_add_and_search_words_data_structure.rs new file mode 100644 index 00000000..c37733a2 --- /dev/null +++ b/src/problem/p0211_design_add_and_search_words_data_structure.rs @@ -0,0 +1,144 @@ +/** + * [211] Design Add and Search Words Data Structure + * + * Design a data structure that supports adding new words and finding if a string matches any previously added string. + * Implement the WordDictionary class: + * + * WordDictionary() Initializes the object. + * void addWord(word) Adds word to the data structure, it can be matched later. + * bool search(word) Returns true if there is any string in the data structure that matches word or false otherwise. word may contain dots '.' where dots can be matched with any letter. + * + * + * Example: + * + * Input + * ["WordDictionary","addWord","addWord","addWord","search","search","search","search"] + * [[],["bad"],["dad"],["mad"],["pad"],["bad"],[".ad"],["b.."]] + * Output + * [null,null,null,null,false,true,true,true] + * Explanation + * WordDictionary wordDictionary = new WordDictionary(); + * wordDictionary.addWord("bad"); + * wordDictionary.addWord("dad"); + * wordDictionary.addWord("mad"); + * wordDictionary.search("pad"); // return False + * wordDictionary.search("bad"); // return True + * wordDictionary.search(".ad"); // return True + * wordDictionary.search("b.."); // return True + * + * + * Constraints: + * + * 1 <= word.length <= 500 + * word in addWord consists lower-case English letters. + * word in search consist of '.' or lower-case English letters. + * At most 50000 calls will be made to addWord and search. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/design-add-and-search-words-data-structure/ +// discuss: https://leetcode.com/problems/design-add-and-search-words-data-structure/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +struct TrieNode { + branches : [Option>;26], + exists : bool, +} + +impl TrieNode { + pub fn new() -> Self { + const NONE: Option> = None; + TrieNode{ + branches : [NONE;26], + exists : false + } + } + pub fn insert(&mut self, word : &str) { + if word == "" { self.exists = true; return; } + let first_char : char = word.chars().next().unwrap(); + let char_pos : usize = (first_char as u8 - 'a' as u8) as usize; + if self.branches[char_pos].is_none() { + self.branches[char_pos] = Some(Box::new(TrieNode::new())); + } + self.branches[char_pos].as_mut().unwrap().insert(&word[1..]); + } + + pub fn search(&self, word : &str) -> bool { + if word == "" { + if self.exists { + return true; + } else { + return false; + } + } + let first_char : char = word.chars().next().unwrap(); + if first_char == '.' { + for i in 0..26 { + if self.branches[i].is_none() {continue} + if self.branches[i].as_ref().unwrap().search(&word[1..]) { + return true; + } + } + false + } else { + let char_pos : usize = (first_char as u8 - 'a' as u8) as usize; + if self.branches[char_pos].is_none() { + false + } else { + self.branches[char_pos].as_ref().unwrap().search(&word[1..]) + } + } + } +} + +struct WordDictionary { + trie : TrieNode +} + + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl WordDictionary { + + /** Initialize your data structure here. */ + fn new() -> Self { + WordDictionary{trie: TrieNode::new()} + } + + fn add_word(&mut self, word: String) { + self.trie.insert(&word); + } + + fn search(&self, word: String) -> bool { + self.trie.search(&word) + } +} + +/** + * Your WordDictionary object will be instantiated and called as such: + * let obj = WordDictionary::new(); + * obj.add_word(word); + * let ret_2: bool = obj.search(word); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_211() { + let mut dict = WordDictionary::new(); + dict.add_word("bad".to_owned()); + dict.add_word("dad".to_owned()); + dict.add_word("mad".to_owned()); + assert_eq!(dict.search("pad".to_owned()), false); + assert_eq!(dict.search("bad".to_owned()), true); + assert_eq!(dict.search(".ad".to_owned()), true); + assert_eq!(dict.search("da.".to_owned()), true); + } +} diff --git a/src/problem/p0212_word_search_ii.rs b/src/problem/p0212_word_search_ii.rs new file mode 100644 index 00000000..8e36e45c --- /dev/null +++ b/src/problem/p0212_word_search_ii.rs @@ -0,0 +1,120 @@ +/** + * [212] Word Search II + * + * Given an m x n board of characters and a list of strings words, return all words on the board. + * Each word must be constructed from letters of sequentially adjacent cells, where adjacent cells are horizontally or vertically neighboring. The same letter cell may not be used more than once in a word. + * + * Example 1: + * + * Input: board = [["o","a","a","n"],["e","t","a","e"],["i","h","k","r"],["i","f","l","v"]], words = ["oath","pea","eat","rain"] + * Output: ["eat","oath"] + * + * Example 2: + * + * Input: board = [["a","b"],["c","d"]], words = ["abcb"] + * Output: [] + * + * + * Constraints: + * + * m == board.length + * n == board[i].length + * 1 <= m, n <= 12 + * board[i][j] is a lowercase English letter. + * 1 <= words.length <= 3 * 10^4 + * 1 <= words[i].length <= 10 + * words[i] consists of lowercase English letters. + * All the strings of words are unique. + * + */ + +// problem: https://leetcode.com/problems/word-search-ii/ +// discuss: https://leetcode.com/problems/word-search-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +pub struct TrieNode{ + branches : Vec>>, + word: Option, +} + +impl TrieNode { + pub fn new_node() -> TrieNode { + TrieNode{ + branches: (0..26).map(|_| None).collect(), + word : None, + } + } + + pub fn build_trie(words : &Vec) -> TrieNode { + let mut root = Self::new_node(); + for word in words.iter() { + let mut node_ptr = &mut root; + for word_char in word.chars() { + let pos : usize = (word_char as u8 - 'a' as u8) as usize; + if node_ptr.branches[pos].is_none() { + node_ptr.branches[pos] = Some(Box::new(TrieNode::new_node())); + } + node_ptr = node_ptr.branches[pos].as_mut().unwrap(); + } + node_ptr.word = Some(word.clone()); + } + root + } +} + +use std::collections::HashSet; +pub struct Solution {} +impl Solution { + pub fn track(board: &mut Vec>, i : i32, j : i32, cur_node : &TrieNode, found : &mut HashSet ) { + let row_count : i32 = board.len() as i32; + let col_count : i32 = board[0].len() as i32; + if cur_node.word.is_some() { + found.insert(cur_node.word.as_ref().unwrap().clone()); + } + + if (0 <= i && i < row_count && 0 <= j && j < col_count && board[i as usize][j as usize] != '#' ) { + let this_char : char = board[i as usize][j as usize]; + let char_idx : usize = (this_char as u8 - 'a' as u8) as usize; + if cur_node.branches[char_idx].is_some() { + let next_node : &TrieNode = cur_node.branches[char_idx].as_ref().unwrap(); + board[i as usize][j as usize] = '#'; + Self::track(board, i-1, j, next_node, found); + Self::track(board, i+1, j, next_node, found); + Self::track(board, i, j-1, next_node, found); + Self::track(board, i, j+1, next_node, found); + board[i as usize][j as usize] = this_char; + } + + } + + } + + pub fn find_words(mut board: Vec>, words: Vec) -> Vec { + let trie : TrieNode = TrieNode::build_trie(&words); + + let mut result : HashSet = HashSet::new(); + for i in 0..board.len() { + for j in 0..board[0].len() { + Self::track(&mut board, i as i32, j as i32, &trie, &mut result); + } + } + // let i = 1usize; + // let j = 3usize; + // Self::track(&mut board, i as i32, j as i32, &trie, &mut result); + result.into_iter().collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_212() { + let board = vec![vec!['o','a','a','n'],vec!['e','t','a','e'],vec!['i','h','k','r'],vec!['i','f','l','v']]; + let words = vec!["oath".to_owned(),"pea".to_owned(),"eat".to_owned(),"rain".to_owned()]; + assert_eq!(Solution::find_words(board, words), vec!["oath","eat"]); + } +} diff --git a/src/problem/p0213_house_robber_ii.rs b/src/problem/p0213_house_robber_ii.rs new file mode 100644 index 00000000..d88cea6c --- /dev/null +++ b/src/problem/p0213_house_robber_ii.rs @@ -0,0 +1,75 @@ +/** + * [213] House Robber II + * + * You are a professional robber planning to rob houses along a street. Each house has a certain amount of money stashed. All houses at this place are arranged in a circle. That means the first house is the neighbor of the last one. Meanwhile, adjacent houses have a security system connected, and it will automatically contact the police if two adjacent houses were broken into on the same night. + * Given an integer array nums representing the amount of money of each house, return the maximum amount of money you can rob tonight without alerting the police. + * + * Example 1: + * + * Input: nums = [2,3,2] + * Output: 3 + * Explanation: You cannot rob house 1 (money = 2) and then rob house 3 (money = 2), because they are adjacent houses. + * + * Example 2: + * + * Input: nums = [1,2,3,1] + * Output: 4 + * Explanation: Rob house 1 (money = 1) and then rob house 3 (money = 3). + * Total amount you can rob = 1 + 3 = 4. + * + * Example 3: + * + * Input: nums = [0] + * Output: 0 + * + * + * Constraints: + * + * 1 <= nums.length <= 100 + * 0 <= nums[i] <= 1000 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/house-robber-ii/ +// discuss: https://leetcode.com/problems/house-robber-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +impl Solution { + pub fn helper(nums: &Vec, start_pos: usize, end_pos: usize) -> i32 { + let mut result: Vec<(i32, i32)> = vec![(0,0);nums.len()]; + result[start_pos] = (nums[start_pos], 0); + for i in (start_pos+1)..end_pos { + let (prev_robbed, prev_unrobbed) = result[i-1]; + let my_robbed = prev_unrobbed + nums[i]; + let my_unrobbed = std::cmp::max(prev_robbed, prev_unrobbed); + result[i] = (my_robbed, my_unrobbed); + } + let (last_robbed, last_unrobbed) = result[end_pos-1]; + std::cmp::max(last_robbed, last_unrobbed) + } + + pub fn rob(nums: Vec) -> i32 { + let l = nums.len(); + if l == 1 { + nums[0] + } else { + std::cmp::max(Self::helper(&nums, 0, l-1), + Self::helper(&nums, 1, l) + ) + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_213() { + assert_eq!(Solution::rob(vec![2, 3, 2]), 3); + assert_eq!(Solution::rob(vec![1, 2, 3, 1]), 4); + } +} diff --git a/src/problem/p0214_shortest_palindrome.rs b/src/problem/p0214_shortest_palindrome.rs new file mode 100644 index 00000000..f472aca1 --- /dev/null +++ b/src/problem/p0214_shortest_palindrome.rs @@ -0,0 +1,64 @@ +/** + * [214] Shortest Palindrome + * + * You are given a string s. You can convert s to a palindrome by adding characters in front of it. + * Return the shortest palindrome you can find by performing this transformation. + * + * Example 1: + * Input: s = "aacecaaa" + * Output: "aaacecaaa" + * Example 2: + * Input: s = "abcd" + * Output: "dcbabcd" + * + * Constraints: + * + * 0 <= s.length <= 5 * 10^4 + * s consists of lowercase English letters only. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/shortest-palindrome/ +// discuss: https://leetcode.com/problems/shortest-palindrome/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn shortest_palindrome(s: String) -> String { + let chars : Vec = s.chars().collect(); + let n : usize = s.len(); + let mut end_pos : usize = 0; // inclusive + // find the longest palindrome start at i + for end in (0..n).rev() { + let l : usize = end + 1; + let mut is_palindrome = true; + for i in 0..=(l/2) { + if chars[i] != chars[l-1-i] { + is_palindrome = false; + break + } + } + if is_palindrome { + end_pos = end; + break; + } + } + let mut result_prefix : Vec = chars.iter().skip(end_pos+1).cloned().rev().collect(); + result_prefix.extend(chars); + result_prefix.into_iter().collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_214() { + assert_eq!(Solution::shortest_palindrome("aacecaaa".to_owned()), "aaacecaaa".to_owned()); + assert_eq!(Solution::shortest_palindrome("abcd".to_owned()), "dcbabcd".to_owned()); + } +} diff --git a/src/problem/p0215_kth_largest_element_in_an_array.rs b/src/problem/p0215_kth_largest_element_in_an_array.rs new file mode 100644 index 00000000..684bec52 --- /dev/null +++ b/src/problem/p0215_kth_largest_element_in_an_array.rs @@ -0,0 +1,69 @@ +/** + * [215] Kth Largest Element in an Array + * + * Given an integer array nums and an integer k, return the k^th largest element in the array. + * Note that it is the k^th largest element in the sorted order, not the k^th distinct element. + * + * Example 1: + * Input: nums = [3,2,1,5,6,4], k = 2 + * Output: 5 + * Example 2: + * Input: nums = [3,2,3,1,2,4,5,5,6], k = 4 + * Output: 4 + * + * Constraints: + * + * 1 <= k <= nums.length <= 10^4 + * -10^4 <= nums[i] <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/kth-largest-element-in-an-array/ +// discuss: https://leetcode.com/problems/kth-largest-element-in-an-array/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_idx_in_sorted(nums : &[i32], target_idx : usize) -> i32 { + let mut le_nums : Vec = vec![]; + let mut gt_nums : Vec = vec![]; + let pivot : i32 = nums[0]; + for &num in nums[1..].iter() { + if num <= pivot { + le_nums.push(num); + } else { + gt_nums.push(num); + } + } + + if le_nums.len() == target_idx { + pivot + } else if le_nums.len() > target_idx { + Self::find_idx_in_sorted(&le_nums, target_idx) + } else { + Self::find_idx_in_sorted(>_nums, target_idx - 1 - le_nums.len()) + } + } + + pub fn find_kth_largest(nums: Vec, k: i32) -> i32 { + let target_sorted_idx : usize = nums.len() - k as usize; + Self::find_idx_in_sorted(&nums, target_sorted_idx) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_215() { + assert_eq!( + Solution::find_kth_largest(vec![3, 2, 3, 1, 2, 4, 5, 5, 6], 4), + 4 + ); + assert_eq!(Solution::find_kth_largest(vec![3, 2, 1, 5, 6, 4], 2), 5); + } +} diff --git a/src/problem/p0216_combination_sum_iii.rs b/src/problem/p0216_combination_sum_iii.rs new file mode 100644 index 00000000..f14703f3 --- /dev/null +++ b/src/problem/p0216_combination_sum_iii.rs @@ -0,0 +1,145 @@ +/** + * [216] Combination Sum III + * + * Find all valid combinations of k numbers that sum up to n such that the following conditions are true: + * + * Only numbers 1 through 9 are used. + * Each number is used at most once. + * + * Return a list of all possible valid combinations. The list must not contain the same combination twice, and the combinations may be returned in any order. + * + * Example 1: + * + * Input: k = 3, n = 7 + * Output: [[1,2,4]] + * Explanation: + * 1 + 2 + 4 = 7 + * There are no other valid combinations. + * Example 2: + * + * Input: k = 3, n = 9 + * Output: [[1,2,6],[1,3,5],[2,3,4]] + * Explanation: + * 1 + 2 + 6 = 9 + * 1 + 3 + 5 = 9 + * 2 + 3 + 4 = 9 + * There are no other valid combinations. + * + * Example 3: + * + * Input: k = 4, n = 1 + * Output: [] + * Explanation: There are no valid combinations. [1,2,1] is not valid because 1 is used twice. + * + * Example 4: + * + * Input: k = 3, n = 2 + * Output: [] + * Explanation: There are no valid combinations. + * + * Example 5: + * + * Input: k = 9, n = 45 + * Output: [[1,2,3,4,5,6,7,8,9]] + * Explanation: + * 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 = 45 + * ​​​​​​​There are no other valid combinations. + * + * + * Constraints: + * + * 2 <= k <= 9 + * 1 <= n <= 60 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/combination-sum-iii/ +// discuss: https://leetcode.com/problems/combination-sum-iii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn backtrack_helper(result : &mut Vec>, tmp : &mut Vec, elements : &Vec, predicate: P, parse: B, start : usize, no_dup : bool, element_reusable : bool) where P:Fn(&Vec>, &Vec)->(bool, bool) + Copy, B:Fn(&Vec,usize,usize)->Option + Copy, R:Clone +Eq + std::fmt::Debug, E:std::fmt::Debug{ + // is_sorted() is only supported in nightly-built rust + // if no_dup && !elements.is_sorted() { + // panic!("Elements must be presorted to deduplicate."); + // } + if no_dup && element_reusable { + panic!("element_reusable and no_dup can NOT be both on. "); + } + let (valid , early_stop) = predicate(result, tmp); + if valid { result.push(tmp.clone()); } + if early_stop {return} + + let n : usize = elements.len(); + let mut last_parsed : Option = None; + let mut start_parse_idx : usize = start; + for i in start..n { + let parsed : Option = parse(elements, start, i); + // println!("elements={:?}, start_idx={}, end={}, parsed={:?}", elements, start, i, parsed); + if parsed.is_none() { + continue; + } + let parsed : R = parsed.unwrap(); + + let mut backtrack = true; + if no_dup && last_parsed.is_some() && last_parsed.as_ref().unwrap().eq(&parsed) { + backtrack = false; + } + + if backtrack { + tmp.push(parsed.clone()); + let next_start = if element_reusable { start_parse_idx} else { i+1 }; + Self::backtrack_helper(result, tmp, elements, predicate, parse, next_start, no_dup, element_reusable); + tmp.pop(); + + } + last_parsed = Some(parsed.clone()); + start_parse_idx = i + 1; + } + } + + + pub fn combination_sum3(k: i32, n: i32) -> Vec> { + let k = k as usize; + let mut result : Vec> = vec![]; + let mut tmp : Vec = vec![]; + // let predicate = ||{} + let elements : Vec = (1..=9).collect(); + let parse = |elements : &Vec, start_idx : usize, cur_idx : usize|{Some(elements[cur_idx])}; + let predicate = |result : &Vec>, tmp : &Vec| { + let mut valid = false; + let mut early_stop = false; + if tmp.iter().sum::() == n && tmp.len() == k { + valid = true; + } + if tmp.len() >= k { + early_stop = true; + } + if tmp.iter().sum::() >= n { + early_stop = true; + } + + (valid, early_stop) + }; + Self::backtrack_helper(&mut result, &mut tmp, &elements, predicate, parse, 0, false, false); + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_216() { + assert_eq!( + Solution::combination_sum3(3, 9), + vec![vec![1, 2, 6], vec![1, 3, 5], vec![2, 3, 4]] + ); + } +} diff --git a/src/problem/p0218_the_skyline_problem.rs b/src/problem/p0218_the_skyline_problem.rs new file mode 100644 index 00000000..6cf2322d --- /dev/null +++ b/src/problem/p0218_the_skyline_problem.rs @@ -0,0 +1,128 @@ +/** + * [218] The Skyline Problem + * + * A city's skyline is the outer contour of the silhouette formed by all the buildings in that city when viewed from a distance. Given the locations and heights of all the buildings, return the skyline formed by these buildings collectively. + * The geometric information of each building is given in the array buildings where buildings[i] = [lefti, righti, heighti]: + * + * lefti is the x coordinate of the left edge of the i^th building. + * righti is the x coordinate of the right edge of the i^th building. + * heighti is the height of the i^th building. + * + * You may assume all buildings are perfect rectangles grounded on an absolutely flat surface at height 0. + * The skyline should be represented as a list of "key points" sorted by their x-coordinate in the form [[x1,y1],[x2,y2],...]. Each key point is the left endpoint of some horizontal segment in the skyline except the last point in the list, which always has a y-coordinate 0 and is used to mark the skyline's termination where the rightmost building ends. Any ground between the leftmost and rightmost buildings should be part of the skyline's contour. + * Note: There must be no consecutive horizontal lines of equal height in the output skyline. For instance, [...,[2 3],[4 5],[7 5],[11 5],[12 7],...] is not acceptable; the three lines of height 5 should be merged into one in the final output as such: [...,[2 3],[4 5],[12 7],...] + * + * Example 1: + * + * Input: buildings = [[2,9,10],[3,7,15],[5,12,12],[15,20,10],[19,24,8]] + * Output: [[2,10],[3,15],[7,12],[12,0],[15,10],[20,8],[24,0]] + * Explanation: + * Figure A shows the buildings of the input. + * Figure B shows the skyline formed by those buildings. The red points in figure B represent the key points in the output list. + * + * Example 2: + * + * Input: buildings = [[0,2,3],[2,5,3]] + * Output: [[0,3],[5,0]] + * + * + * Constraints: + * + * 1 <= buildings.length <= 10^4 + * 0 <= lefti < righti <= 2^31 - 1 + * 1 <= heighti <= 2^31 - 1 + * buildings is sorted by lefti in non-decreasing order. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/the-skyline-problem/ +// discuss: https://leetcode.com/problems/the-skyline-problem/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn get_skyline(buildings: Vec>) -> Vec> { + let mut critical_points : Vec<(i32, i32, usize, bool)> = vec![]; + for (i, building) in buildings.iter().enumerate() { + critical_points.push((building[0], building[2], i, true)); + critical_points.push((building[1], building[2], i, false)); + } + + critical_points.sort_by(|x,y|{ + if x.0 < y.0 { + return std::cmp::Ordering::Less; + } else if x.0 > y.0 { + return std::cmp::Ordering::Greater; + + // Equal horizontal coordinate + } else if x.3 && !y.3{ + // place the starting rectangle ahead, which is x. + return std::cmp::Ordering::Less; + } else if y.3 && !x.3{ + // place the starting rectangle ahead, which is y. + return std::cmp::Ordering::Greater; + } else if x.3 && y.3 { + // both the starting rectangle, sorted in reverse order by height. + return y.1.cmp(&x.1); + } else { + // both the ending rectangle, sorted in order by height. + return x.1.cmp(&y.1); + } + }); + // println!("sorted critical_points : {:?}", critical_points); + + let mut active_rects : HashMap = HashMap::new(); + let mut cur_max_height : i32 = 0; + let mut result : Vec> = vec![]; + for critical_point in critical_points.iter() { + let x : i32 = critical_point.0; + let y : i32 = critical_point.1; + let rect_id : usize = critical_point.2; + if critical_point.3 { + // is left, a new rectangle starts + active_rects.insert(rect_id, y); + let new_max_height : i32 = *active_rects.values().max().unwrap(); + if cur_max_height < new_max_height { + result.push(vec![x, new_max_height]); + cur_max_height = new_max_height; + } + + } else { + // is left, a rectangle ends + active_rects.remove(&rect_id); + if let Some(&new_max_height) = active_rects.values().max() { + if new_max_height < cur_max_height { + result.push(vec![x, new_max_height]); + cur_max_height = new_max_height; + } + } else { + // no active rectangle + result.push(vec![x, 0]); + cur_max_height = 0; + } + + } + + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_218() { + assert_eq!(Solution::get_skyline(vec![vec![2,9,10],vec![3,7,15],vec![5,12,12],vec![15,20,10],vec![19,24,8]]), vec![vec![2,10],vec![3,15],vec![7,12],vec![12,0],vec![15,10],vec![20,8],vec![24,0]]); + + // two continuous buildings + assert_eq!(Solution::get_skyline(vec![vec![0,2,3],vec![2,5,3]]), vec![vec![0,3],vec![5,0]]); + + // three buildings stacked vertically + assert_eq!(Solution::get_skyline(vec![vec![1,2,1],vec![1,2,2], vec![1,2,3]]), vec![vec![1,3],vec![2,0]]); + } +} diff --git a/src/problem/p0220_contains_duplicate_iii.rs b/src/problem/p0220_contains_duplicate_iii.rs new file mode 100644 index 00000000..ceee2935 --- /dev/null +++ b/src/problem/p0220_contains_duplicate_iii.rs @@ -0,0 +1,93 @@ +/** + * [220] Contains Duplicate III + * + * Given an integer array nums and two integers k and t, return true if there are two distinct indices i and j in the array such that abs(nums[i] - nums[j]) <= t and abs(i - j) <= k. + * + * Example 1: + * Input: nums = [1,2,3,1], k = 3, t = 0 + * Output: true + * Example 2: + * Input: nums = [1,0,1,1], k = 1, t = 2 + * Output: true + * Example 3: + * Input: nums = [1,5,9,1,5,9], k = 2, t = 3 + * Output: false + * + * Constraints: + * + * 0 <= nums.length <= 2 * 10^4 + * -2^31 <= nums[i] <= 2^31 - 1 + * 0 <= k <= 10^4 + * 0 <= t <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/contains-duplicate-iii/ +// discuss: https://leetcode.com/problems/contains-duplicate-iii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::{collections::HashMap, hash::Hash}; +impl Solution { + + fn bucket_idx(num: i64, t: i64) -> i64 { + let mut bkt_idx = num / (t + 1) as i64; + if num < 0 {bkt_idx -= 1;} + bkt_idx + } + + pub fn contains_nearby_almost_duplicate(nums: Vec, k: i64, t: i64) -> bool { + let mut buckets = HashMap::new(); + for (i, &num) in nums.iter().enumerate() { + println!("i = {}, num = {}", i, num); + let num = num as i64; + let bkt_idx = Self::bucket_idx(num, t); + println!("\t bkt_idx = {}", bkt_idx); + if let Some(_) = buckets.get(&(bkt_idx)) { + return true; + } + + if let Some(&pred_num) = buckets.get(&(bkt_idx-1)) { + println!("\t pred_num = {}", pred_num); + if ((pred_num - num) as i64).abs() <= t { + return true; + } + } + + if let Some(sub_num) = buckets.get(&(bkt_idx+1)) { + println!("\t sub_num = {}", sub_num); + if ((sub_num - num) as i64).abs() <= t { + return true; + } + } + // remove (i-k)-th element from the bucket + let k = k as usize; + buckets.insert(bkt_idx, num); + if k <= i { + buckets.remove(&Self::bucket_idx(nums[i-k] as i64, t)); + } + println!("\tbuckets = {:?}", buckets); + } + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_220() { + // assert_eq!(Solution::contains_nearby_almost_duplicate(vec![1,5,9,1,5,9], 2, 3), false); + // assert_eq!(Solution::contains_nearby_almost_duplicate(vec![1,2,3,1], 3, 0), true); + // assert_eq!( + // Solution::contains_nearby_almost_duplicate(vec![-1, 2147483647], 1, 2147483647), + // false + // ); + // assert_eq!(Solution::contains_nearby_almost_duplicate(vec![-3,3,6], 2, 3), true); + // assert_eq!(Solution::contains_nearby_almost_duplicate(vec![1,2], 0, 1), false); + assert_eq!(Solution::contains_nearby_almost_duplicate(vec![3,6, 0, 4], 2, 2), true); + } +} diff --git a/src/problem/p0221_maximal_square.rs b/src/problem/p0221_maximal_square.rs new file mode 100644 index 00000000..ca191e10 --- /dev/null +++ b/src/problem/p0221_maximal_square.rs @@ -0,0 +1,127 @@ +/** + * [221] Maximal Square + * + * Given an m x n binary matrix filled with 0's and 1's, find the largest square containing only 1's and return its area. + * + * Example 1: + * + * Input: matrix = [["1","0","1","0","0"],["1","0","1","1","1"],["1","1","1","1","1"],["1","0","0","1","0"]] + * Output: 4 + * + * Example 2: + * + * Input: matrix = [["0","1"],["1","0"]] + * Output: 1 + * + * Example 3: + * + * Input: matrix = [["0"]] + * Output: 0 + * + * + * Constraints: + * + * m == matrix.length + * n == matrix[i].length + * 1 <= m, n <= 300 + * matrix[i][j] is '0' or '1'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/maximal-square/ +// discuss: https://leetcode.com/problems/maximal-square/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn maximal_square(matrix: Vec>) -> i32 { + let row_count : usize = matrix.len(); + let col_count : usize = matrix[0].len(); + let mut heights : Vec = vec![0usize;col_count]; + let mut last_shorter_positions : Vec = vec![0i32;col_count]; + let mut next_shorter_positions : Vec = vec![0i32;col_count]; + + let mut max_dim : usize = 0; + for i in 0..row_count { + for j in 0..col_count { + if matrix[i][j] == '0' { + heights[j] = 0; + } else { + heights[j] += 1; + } + } + + + let mut index_min_stack : Vec = vec![]; + for j in 0..col_count { + let mut last_shorter_pos : i32 = -1; + while let Some(&last_pos) = index_min_stack.last() { + if heights[last_pos] < heights[j] { + last_shorter_pos = last_pos as i32; + break; + } else { + index_min_stack.pop(); + } + } + index_min_stack.push(j); + last_shorter_positions[j] = last_shorter_pos; + } + + let mut index_min_stack : Vec = vec![]; + for j in (0..col_count).rev() { + let mut next_shorter_pos : i32 = col_count as i32; + while let Some(&next_pos) = index_min_stack.last() { + if heights[next_pos] < heights[j] { + next_shorter_pos = next_pos as i32; + break; + } else { + index_min_stack.pop(); + } + } + index_min_stack.push(j); + next_shorter_positions[j] = next_shorter_pos; + } + + for j in 0..col_count { + // println!("i={}, j={}, last_shorter_pos={}, next_shorter_pos={}, height={}", i, j, last_shorter_positions[j], next_shorter_positions[j], heights[j]); + + let width : usize = (next_shorter_positions[j] - last_shorter_positions[j] - 1) as usize; + let this_dim : usize = std::cmp::min(width, heights[j]); + max_dim = std::cmp::max(max_dim, this_dim); + } + } + (max_dim * max_dim) as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_221() { + assert_eq!( + Solution::maximal_square(vec![ + vec!['1', '0', '1', '0', '0'], + vec!['1', '0', '1', '1', '1'], + vec!['1', '1', '1', '1', '1'], + vec!['1', '0', '0', '1', '0'], + ]), + 4 + ); + + assert_eq!( + Solution::maximal_square(vec![ + vec!['0','0','0','1'], + vec!['1','1','0','1'], + vec!['1','1','1','1'], + vec!['0','1','1','1'], + vec!['0','1','1','1'] + ]), + 9 + ) + } +} diff --git a/src/problem/p0222_count_complete_tree_nodes.rs b/src/problem/p0222_count_complete_tree_nodes.rs new file mode 100644 index 00000000..971b414b --- /dev/null +++ b/src/problem/p0222_count_complete_tree_nodes.rs @@ -0,0 +1,110 @@ +/** + * [222] Count Complete Tree Nodes + * + * Given the root of a complete binary tree, return the number of the nodes in the tree. + * According to Wikipedia, every level, except possibly the last, is completely filled in a complete binary tree, and all nodes in the last level are as far left as possible. It can have between 1 and 2^h nodes inclusive at the last level h. + * + * Example 1: + * + * Input: root = [1,2,3,4,5,6] + * Output: 6 + * + * Example 2: + * + * Input: root = [] + * Output: 0 + * + * Example 3: + * + * Input: root = [1] + * Output: 1 + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 5 * 10^4]. + * 0 <= Node.val <= 5 * 10^4 + * The tree is guaranteed to be complete. + * + * + * Follow up: Traversing the tree to count the number of nodes in the tree is an easy solution but with O(n) complexity. Could you find a faster algorithm? + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/count-complete-tree-nodes/ +// discuss: https://leetcode.com/problems/count-complete-tree-nodes/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn left_depth(root : &Option>>) -> u32 { + if let Some(node) = root { + return 1 + Self::left_depth(&node.borrow().left) + } else { + return 0; + } + } + + pub fn right_depth(root : &Option>>) -> u32 { + if let Some(node) = root { + return 1 + Self::right_depth(&node.borrow().right) + } else { + return 0; + } + } + + pub fn count_nodes(root: Option>>) -> i32 { + if let Some(node) = root { + let left_level = Self::left_depth(&node.borrow().left); + let right_level = Self::right_depth(&node.borrow().right); + // println!("val={}, left_level={}, right_level={}", node.borrow().val, left_level, right_level); + if left_level == right_level { + return 1 + (2i32.pow(left_level) - 1) + (2i32.pow(right_level) - 1); + } else { + let mut node_borrow = node.borrow_mut(); + return 1 + Self::count_nodes(node_borrow.left.take()) + Self::count_nodes(node_borrow.right.take()); + } + } else { + return 0; + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_222() { + assert_eq!(Solution::count_nodes(tree![1, 2, 3, 4, 5, 6]), 6); + assert_eq!(Solution::count_nodes(tree![1, 1, 1, 1, 1, 1, 1]), 7); + assert_eq!(Solution::count_nodes(tree![]), 0); + assert_eq!(Solution::count_nodes(tree![1, 1]), 2); + assert_eq!(Solution::count_nodes(tree![1]), 1); + assert_eq!(Solution::count_nodes(tree![1, 1, 1]), 3); + assert_eq!(Solution::count_nodes(tree![1, 2, 3, 4]), 4); + } +} diff --git a/src/problem/p0223_rectangle_area.rs b/src/problem/p0223_rectangle_area.rs new file mode 100644 index 00000000..5b9f5f70 --- /dev/null +++ b/src/problem/p0223_rectangle_area.rs @@ -0,0 +1,66 @@ +/** + * [223] Rectangle Area + * + * Given the coordinates of two rectilinear rectangles in a 2D plane, return the total area covered by the two rectangles. + * The first rectangle is defined by its bottom-left corner (A, B) and its top-right corner (C, D). + * The second rectangle is defined by its bottom-left corner (E, F) and its top-right corner (G, H). + * + * Example 1: + * Rectangle Area + * Input: A = -3, B = 0, C = 3, D = 4, E = 0, F = -1, G = 9, H = 2 + * Output: 45 + * + * Example 2: + * + * Input: A = -2, B = -2, C = 2, D = 2, E = -2, F = -2, G = 2, H = 2 + * Output: 16 + * + * + * Constraints: + * + * -10^4 <= A, B, C, D, E, F, G, H <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/rectangle-area/ +// discuss: https://leetcode.com/problems/rectangle-area/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn overlap(i1: (i32, i32), i2: (i32, i32)) -> i32 { + let max_start = std::cmp::max(i1.0, i2.0); + let min_end = std::cmp::min(i1.1, i2.1); + if max_start < min_end { + min_end - max_start + } else { + 0 + } + } + + pub fn area(lower_left: (i32, i32), upper_right: (i32, i32)) -> i32 { + (upper_right.0 - lower_left.0) * (upper_right.1 - lower_left.1) + } + + pub fn compute_area(a: i32, b: i32, c: i32, d: i32, e: i32, f: i32, g: i32, h: i32) -> i32 { + let overlap_x = Self::overlap((a, c), (e, g)); + let overlap_y = Self::overlap((b, d), (f, h)); + Self::area((a, b),(c, d)) + Self::area((e,f), (g,h)) - overlap_x * overlap_y + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_223() { + assert_eq!(Solution::compute_area(0, 0, 0, 0, 0, 0, 0, 0), 0); + assert_eq!(Solution::compute_area(-3, 0, 3, 4, 0, -1, 9, 2), 45); + assert_eq!(Solution::compute_area(-2, -2, 2, 2, -2, -2, 2, 2), 16); + assert_eq!(Solution::compute_area(-2, -2, 2, 2, -1, 4, 1, 6), 20); + } +} diff --git a/src/problem/p0224_basic_calculator.rs b/src/problem/p0224_basic_calculator.rs new file mode 100644 index 00000000..bc98c04d --- /dev/null +++ b/src/problem/p0224_basic_calculator.rs @@ -0,0 +1,108 @@ +/** + * [224] Basic Calculator + * + * Given a string s representing an expression, implement a basic calculator to evaluate it. + * + * Example 1: + * + * Input: s = "1 + 1" + * Output: 2 + * + * Example 2: + * + * Input: s = " 2-1 + 2 " + * Output: 3 + * + * Example 3: + * + * Input: s = "(1+(4+5+2)-3)+(6+8)" + * Output: 23 + * + * + * Constraints: + * + * 1 <= s.length <= 3 * 10^5 + * s consists of digits, '+', '-', '(', ')', and ' '. + * s represents a valid expression. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/basic-calculator/ +// discuss: https://leetcode.com/problems/basic-calculator/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn recursive_compute(s : &Vec, start : usize, end : usize, level : usize) -> i32 { + let mut base : i32 = 0; + let mut prev_op : char = '+'; + let mut prev_num : i32 = 0; + + let mut i : usize = start; + while i < end { + // println!("start={}, end = {}, i={}, base={}, prev_op={}, prev_num={}", start, end, i, base, prev_op, prev_num); + if s[i] == ' ' { + // do nothing + } else if s[i] == '+' || s[i] == '-' { + if prev_op == '+' { + base += prev_num; + } else { + base -= prev_num; + } + prev_op = s[i]; + prev_num = 0; + } else if s[i].is_ascii_digit() { + let digit : i32 = (s[i] as u8 - '0' as u8) as i32; + prev_num = 10 * prev_num + digit; + + } else if s[i] == '(' { + let open_pos : usize = i; + + let mut stack : Vec = vec![s[i]]; + loop { + i += 1; + if s[i] == ')' { + while let Some(last_char) = stack.pop() { + if last_char == '(' {break} + } + if stack.len()==0 { break} + } else { + stack.push(s[i]); + } + } + let close_pos : usize = i; + prev_num = Self::recursive_compute(s, open_pos + 1, close_pos, level + 1); + } else { + panic!("Unrecognized char {} at {}", s[i], i); + } + i += 1; + } + + if prev_op == '+' { + base += prev_num; + } else { + base -= prev_num; + } + base + } + pub fn calculate(s: String) -> i32 { + let s : Vec = s.chars().collect(); + Self::recursive_compute(&s, 0, s.len(), 0) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_224() { + assert_eq!(Solution::calculate("(1+(4+5+2)-3)+(6+8)".to_owned()), 23); + assert_eq!(Solution::calculate("1+1".to_owned()), 2); + assert_eq!(Solution::calculate("0".to_owned()), 0); + assert_eq!(Solution::calculate("2147483647".to_owned()), 2147483647); + } +} diff --git a/src/problem/p0226_invert_binary_tree.rs b/src/problem/p0226_invert_binary_tree.rs new file mode 100644 index 00000000..9d6528f3 --- /dev/null +++ b/src/problem/p0226_invert_binary_tree.rs @@ -0,0 +1,84 @@ +/** + * [226] Invert Binary Tree + * + * Given the root of a binary tree, invert the tree, and return its root. + * + * Example 1: + * + * Input: root = [4,2,7,1,3,6,9] + * Output: [4,7,2,9,6,3,1] + * + * Example 2: + * + * Input: root = [2,1,3] + * Output: [2,3,1] + * + * Example 3: + * + * Input: root = [] + * Output: [] + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 100]. + * -100 <= Node.val <= 100 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/invert-binary-tree/ +// discuss: https://leetcode.com/problems/invert-binary-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::{RefCell, RefMut}; + +impl Solution { + pub fn invert_tree(root: Option>>) -> Option>> { + if let Some(node) = root.clone() { + Solution::invert_tree(node.borrow().right.clone()); + Solution::invert_tree(node.borrow().left.clone()); + let left = node.borrow().left.clone(); + let right = node.borrow().right.clone(); + node.borrow_mut().left = right; + node.borrow_mut().right = left; + } + root + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_226() { + assert_eq!( + Solution::invert_tree(tree![4, 2, 7, 1, 3, 6, 9]), + tree![4, 7, 2, 9, 6, 3, 1] + ); + } +} diff --git a/src/problem/p0227_basic_calculator_ii.rs b/src/problem/p0227_basic_calculator_ii.rs new file mode 100644 index 00000000..21422f27 --- /dev/null +++ b/src/problem/p0227_basic_calculator_ii.rs @@ -0,0 +1,85 @@ +/** + * [227] Basic Calculator II + * + * Given a string s which represents an expression, evaluate this expression and return its value. + * The integer division should truncate toward zero. + * Note: You are not allowed to use any built-in function which evaluates strings as mathematical expressions, such as eval(). + * + * Example 1: + * Input: s = "3+2*2" + * Output: 7 + * Example 2: + * Input: s = " 3/2 " + * Output: 1 + * Example 3: + * Input: s = " 3+5 / 2 " + * Output: 5 + * + * Constraints: + * + * 1 <= s.length <= 3 * 10^5 + * s consists of integers and operators ('+', '-', '*', '/') separated by some number of spaces. + * s represents a valid expression. + * All the integers in the expression are non-negative integers in the range [0, 2^31 - 1]. + * The answer is guaranteed to fit in a 32-bit integer. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/basic-calculator-ii/ +// discuss: https://leetcode.com/problems/basic-calculator-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + fn process(to_sum : &mut Vec, last_op : char, last_num : i32) { + if last_op == '+' { + to_sum.push(last_num); + } else if last_op == '-' { + to_sum.push(0 - last_num); + } else if last_op == '*' { + let prev_num : i32 = to_sum.pop().unwrap(); + to_sum.push(prev_num * last_num); + } else { + let prev_num : i32 = to_sum.pop().unwrap(); + to_sum.push(prev_num / last_num); + } + } + + pub fn calculate(s: String) -> i32 { + let s : Vec = s.chars().collect(); + let mut to_sum : Vec = vec![]; + let mut i : usize = 0; + let mut last_op : char = '+'; + let mut last_num : i32 = 0; + while i < s.len() { + if s[i] == ' ' { + // do nothing + } else if s[i] == '+' || s[i] == '-' || s[i] == '*' || s[i] == '/' { + Self::process(&mut to_sum, last_op, last_num); + + last_op = s[i]; + last_num = 0; + } else { + last_num = last_num * 10 + ((s[i] as u8 - '0' as u8) as i32); + } + + i+=1; + } + Self::process(&mut to_sum, last_op, last_num); + to_sum.iter().sum() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_227() { + // assert_eq!(Solution::calculate("3+2*2".to_owned()), 7); + assert_eq!(Solution::calculate(" 3/2 ".to_owned()), 1); + } +} diff --git a/src/problem/p0229_majority_element_ii.rs b/src/problem/p0229_majority_element_ii.rs new file mode 100644 index 00000000..5b5fb04d --- /dev/null +++ b/src/problem/p0229_majority_element_ii.rs @@ -0,0 +1,99 @@ +/** + * [229] Majority Element II + * + * Given an integer array of size n, find all elements that appear more than ⌊ n/3 ⌋ times. + * Follow-up: Could you solve the problem in linear time and in O(1) space? + * + * Example 1: + * + * Input: nums = [3,2,3] + * Output: [3] + * + * Example 2: + * + * Input: nums = [1] + * Output: [1] + * + * Example 3: + * + * Input: nums = [1,2] + * Output: [1,2] + * + * + * Constraints: + * + * 1 <= nums.length <= 5 * 10^4 + * -10^9 <= nums[i] <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/majority-element-ii/ +// discuss: https://leetcode.com/problems/majority-element-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn majority_element(nums: Vec) -> Vec { + let mut candidate1 = None; + let mut candidate2 = None; + let mut count1 = 0usize; + let mut count2 = 0usize; + + for &num in &nums { + if Some(num) == candidate1 { + count1+=1; + } else if Some(num) == candidate2 { + count2+=1; + } else if count1 == 0 { + candidate1 = Some(num); + count1=1; + } else if count2 == 0 { + candidate2 = Some(num); + count2=1; + } else { + count1-=1; + count2-=1; + } + // if count1 == 0 {candidate1=None;} + // if count2 == 0 {candidate2=None;} + } + + let mut result = vec![]; + if let Some(candidate_num) = candidate1 { + if nums.iter().filter(|&x|{*x==candidate_num}).count() > nums.len()/3 { + result.push(candidate_num); + } + } + + if let Some(candidate_num) = candidate2 { + if nums.iter().filter(|&x|{*x==candidate_num}).count() > nums.len()/3 { + result.push(candidate_num); + } + } + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_229() { + // assert_eq!( + // Solution::majority_element(vec![1, 1, 1, 2, 2, 2, 3, 3, 3]), + // vec![] + // ); + assert_eq!( + Solution::majority_element(vec![1, 1, 1, 2, 2, 3, 3, 3]), + vec![1, 3] + ); + assert_eq!(Solution::majority_element(vec![1]), vec![1]); + assert_eq!(Solution::majority_element(vec![5, 6, 6]), vec![6]); + // assert_eq!(Solution::majority_element(vec![1, 2, 3, 4]), vec![]); + } +} diff --git a/src/problem/p0230_kth_smallest_element_in_a_bst.rs b/src/problem/p0230_kth_smallest_element_in_a_bst.rs new file mode 100644 index 00000000..85866a19 --- /dev/null +++ b/src/problem/p0230_kth_smallest_element_in_a_bst.rs @@ -0,0 +1,91 @@ +/** + * [230] Kth Smallest Element in a BST + * + * Given the root of a binary search tree, and an integer k, return the k^th (1-indexed) smallest element in the tree. + * + * Example 1: + * + * Input: root = [3,1,4,null,2], k = 1 + * Output: 1 + * + * Example 2: + * + * Input: root = [5,3,6,2,4,null,null,1], k = 3 + * Output: 3 + * + * + * Constraints: + * + * The number of nodes in the tree is n. + * 1 <= k <= n <= 10^4 + * 0 <= Node.val <= 10^4 + * + * + * Follow up: If the BST is modified often (i.e., we can do insert and delete operations) and you need to find the kth smallest frequently, how would you optimize? + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/kth-smallest-element-in-a-bst/ +// discuss: https://leetcode.com/problems/kth-smallest-element-in-a-bst/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn helper(root: Option>>, k: usize) -> (Option, usize) { + match(root) { + None =>{(None, 0)} + Some(node)=> { + let (found, left_node_count) = Self::helper(node.borrow_mut().left.take(), k); + if found.is_some() { + (found, 0) + } else if left_node_count == k - 1 { + (Some(node.borrow().val), 0) + } else { + let (found, right_node_count) = Self::helper(node.borrow_mut().right.take(), k-1-left_node_count); + // assume such value must be found. + (found, left_node_count + 1 + right_node_count) + } + } + } + } + + pub fn kth_smallest(root: Option>>, k: i32) -> i32 { + let (found, _) = Self::helper(root, k as usize); + found.unwrap() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_230() { + assert_eq!(Solution::kth_smallest(tree![3, 1, 4, null, 2], 1), 1); + assert_eq!(Solution::kth_smallest(tree![3, 1, 4, null, 2], 2), 2); + assert_eq!(Solution::kth_smallest(tree![3, 1, 4, null, 2], 3), 3); + } +} diff --git a/src/problem/p0233_number_of_digit_one.rs b/src/problem/p0233_number_of_digit_one.rs new file mode 100644 index 00000000..ba85d3ea --- /dev/null +++ b/src/problem/p0233_number_of_digit_one.rs @@ -0,0 +1,143 @@ +/** + * [233] Number of Digit One + * + * Given an integer n, count the total number of digit 1 appearing in all non-negative integers less than or equal to n. + * + * Example 1: + * + * Input: n = 13 + * Output: 6 + * + * Example 2: + * + * Input: n = 0 + * Output: 0 + * + * + * Constraints: + * + * 0 <= n <= 2 * 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/number-of-digit-one/ +// discuss: https://leetcode.com/problems/number-of-digit-one/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn count_digit_one(n: i32) -> i32 { + let mut k : i32 = 1; + let mut count : i32 = 0; + + let mut digit_count : usize = 0; + let mut tmp : usize = n as usize; + while tmp != 0 { + digit_count+=1; + tmp = tmp / 10; + } + + for i in 0..digit_count { + let base : i32 = usize::pow(10usize, i as u32) as i32; + let upper : i32 = n / base; // i-th digit inclusive + let lower : i32 = n % base; + let mut this_digit_count : i32 = 0; + if upper % 10 > 1 { + this_digit_count = (upper / 10 + 1) * base; + } else if upper % 10 == 1 { + this_digit_count = upper / 10 * base + lower + 1; + } else { + this_digit_count = upper / 10 * base; + } + // println!("i={}, upper={},lower={}, this_digit_count={}", i, upper, lower, this_digit_count); + count += this_digit_count; + } + count + } + + pub fn count_digit_one_official(n: i32) -> i32 { + let mut k : i32 = 1; + let mut count : i32 = 0; + + let mut digit_count : usize = 0; + let mut tmp : usize = n as usize; + while tmp != 0 { + digit_count+=1; + tmp = tmp / 10; + } + + for i in 0..digit_count { + let k : i32 = usize::pow(10usize, i as u32) as i32; + // e.g, i=2, 12145 -> up: 121, down=45 + let up : i32 = n / k; // all prefix digits until i inclusive + let down : i32 = n % k; // all suffix digits from i exclusive + + // count the 1-occurrence at bit-1, which happens once for every 10. + // up/10*k = 121 / 10 * 100 = 1200 + // [00100-01100], [01100-02100] ... [11100-12100] + count += up / 10 * k; + + if up % 10 == 1 { + // count i-th bit 1 in a subset range. + // e.g, i = 0, in the range (12100, 12145) + // down + 1 = 46 + count += down + 1; + } else if up % 10 > 1 { + // 1 has surpassed on at i-th bit. Count the this range + // e.g., i=3, up %2==2, additionally count i-th bit + count += k; + } + } + count + } + + pub fn my_count_digit_one(n: i32) -> i32 { + if n <= 0 { + return 0; + } + + let mut digit_count : usize = 0; + let mut highest_digit : usize = n as usize; + let mut tmp : usize = n as usize; + while tmp != 0 { + digit_count+=1; + highest_digit = tmp; + tmp = tmp / 10; + } + + let highest_digit : usize = highest_digit as usize; + let highest_order : usize = digit_count - 1; + let mut result : usize = 0; + for i in 0..highest_digit { + if i == 1 { + result += usize::pow(10usize, highest_order as u32); + } + if 0 < highest_order { + result += highest_order * usize::pow(10usize, (highest_order - 1) as u32); + } + } + + let remain : usize = n as usize - highest_digit * usize::pow(10usize, highest_order as u32); + if highest_digit == 1 { + result += remain + 1; + } + println!("highest_order: {}, highest_digit: {}, remain: {}, this_result: {}", highest_order, highest_digit, remain, result); + + let rest_result : usize = Self::count_digit_one(remain as i32) as usize; + result += rest_result; + result as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_233() { + assert_eq!(Solution::count_digit_one(13), 6); + } +} diff --git a/src/problem/p0234_palindrome_linked_list.rs b/src/problem/p0234_palindrome_linked_list.rs new file mode 100644 index 00000000..9d4d2169 --- /dev/null +++ b/src/problem/p0234_palindrome_linked_list.rs @@ -0,0 +1,87 @@ +/** + * [234] Palindrome Linked List + * + * Given the head of a singly linked list, return true if it is a palindrome. + * + * Example 1: + * + * Input: head = [1,2,2,1] + * Output: true + * + * Example 2: + * + * Input: head = [1,2] + * Output: false + * + * + * Constraints: + * + * The number of nodes in the list is in the range [1, 10^5]. + * 0 <= Node.val <= 9 + * + * + * Follow up: Could you do it in O(n) time and O(1) space? + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/palindrome-linked-list/ +// discuss: https://leetcode.com/problems/palindrome-linked-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn reverse(head: &Option>) -> Option> { + let mut reversed : Option> = None; + let mut unreversed : &Option> = head; + while let Some(ref node) = unreversed { + unreversed = &(node.next); + let mut new_node : Box = Box::new(ListNode::new(node.val)); + new_node.next = reversed; + reversed = Some(new_node); + } + reversed + } + + pub fn is_palindrome(head: Option>) -> bool { + let reversed : Option> = Self::reverse(&head); + let mut node : &Option> = &head; + let mut rev_node : &Option> = &reversed; + + while node.is_some() { + if node.as_ref().unwrap().val != rev_node.as_ref().unwrap().val {return false;} + node = &node.as_ref().unwrap().next; + rev_node = &rev_node.as_ref().unwrap().next; + } + true + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_234() { + assert!(Solution::is_palindrome(linked![1, 2, 2,1])); + assert!(!Solution::is_palindrome(linked![1, 2])); + } +} diff --git a/src/problem/p0235_lowest_common_ancestor_of_a_binary_search_tree.rs b/src/problem/p0235_lowest_common_ancestor_of_a_binary_search_tree.rs new file mode 100644 index 00000000..92faae66 --- /dev/null +++ b/src/problem/p0235_lowest_common_ancestor_of_a_binary_search_tree.rs @@ -0,0 +1,99 @@ +/** + * [235] Lowest Common Ancestor of a Binary Search Tree + * + * Given a binary search tree (BST), find the lowest common ancestor (LCA) of two given nodes in the BST. + * According to the definition of LCA on Wikipedia: “The lowest common ancestor is defined between two nodes p and q as the lowest node in T that has both p and q as descendants (where we allow a node to be a descendant of itself).” + * + * Example 1: + * + * Input: root = [6,2,8,0,4,7,9,null,null,3,5], p = 2, q = 8 + * Output: 6 + * Explanation: The LCA of nodes 2 and 8 is 6. + * + * Example 2: + * + * Input: root = [6,2,8,0,4,7,9,null,null,3,5], p = 2, q = 4 + * Output: 2 + * Explanation: The LCA of nodes 2 and 4 is 2, since a node can be a descendant of itself according to the LCA definition. + * + * Example 3: + * + * Input: root = [2,1], p = 2, q = 1 + * Output: 2 + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [2, 10^5]. + * -10^9 <= Node.val <= 10^9 + * All Node.val are unique. + * p != q + * p and q will exist in the BST. + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/lowest-common-ancestor-of-a-binary-search-tree/ +// discuss: https://leetcode.com/problems/lowest-common-ancestor-of-a-binary-search-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + pub fn helper(root: &Option>>, p: &Option>>, q: &Option>>) -> Option>> { + let p_value = p.as_ref().unwrap().borrow().val; + let q_value = q.as_ref().unwrap().borrow().val; + let r_value = root.as_ref().unwrap().borrow().val; + + if r_value == p_value || r_value == q_value || (p_value < r_value && r_value < q_value){ + Some(Rc::new(RefCell::new(TreeNode::new(r_value)))) + } else if q_value < r_value { + Self::helper(&root.as_ref().unwrap().borrow().left, p, q) + } else if r_value < p_value { + Self::helper(&root.as_ref().unwrap().borrow().right, p, q) + } else { + panic!("Not here") + } + } + + pub fn lowest_common_ancestor(root: Option>>, p: Option>>, q: Option>>) -> Option>> { + let p_value = p.as_ref().unwrap().borrow().val; + let q_value = q.as_ref().unwrap().borrow().val; + if p_value < q_value { + Self::helper(&root, &p, &q) + } else { + Self::helper(&root, &q, &p) + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_235() { + } +} diff --git a/src/problem/p0236_lowest_common_ancestor_of_a_binary_tree.rs b/src/problem/p0236_lowest_common_ancestor_of_a_binary_tree.rs new file mode 100644 index 00000000..3b3c0333 --- /dev/null +++ b/src/problem/p0236_lowest_common_ancestor_of_a_binary_tree.rs @@ -0,0 +1,93 @@ +/** + * [236] Lowest Common Ancestor of a Binary Tree + * + * Given a binary tree, find the lowest common ancestor (LCA) of two given nodes in the tree. + * According to the definition of LCA on Wikipedia: “The lowest common ancestor is defined between two nodes p and q as the lowest node in T that has both p and q as descendants (where we allow a node to be a descendant of itself).” + * + * Example 1: + * + * Input: root = [3,5,1,6,2,0,8,null,null,7,4], p = 5, q = 1 + * Output: 3 + * Explanation: The LCA of nodes 5 and 1 is 3. + * + * Example 2: + * + * Input: root = [3,5,1,6,2,0,8,null,null,7,4], p = 5, q = 4 + * Output: 5 + * Explanation: The LCA of nodes 5 and 4 is 5, since a node can be a descendant of itself according to the LCA definition. + * + * Example 3: + * + * Input: root = [1,2], p = 1, q = 2 + * Output: 1 + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [2, 10^5]. + * -10^9 <= Node.val <= 10^9 + * All Node.val are unique. + * p != q + * p and q will exist in the tree. + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/lowest-common-ancestor-of-a-binary-tree/ +// discuss: https://leetcode.com/problems/lowest-common-ancestor-of-a-binary-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +impl Solution { + // adjust the semantics that it returns either of 1 node if only containing one of them. + pub fn lowest_common_ancestor(root: Option>>, p: Option>>, q: Option>>) -> Option>> { + + if root.is_none() || root == p || root == q { + root + } else { + let left_found = Self::lowest_common_ancestor(root.as_ref().unwrap().borrow_mut().left.take(), p.clone(), q.clone()); + let right_found = Self::lowest_common_ancestor(root.as_ref().unwrap().borrow_mut().right.take(), p.clone(), q.clone()); + if left_found.is_some() && right_found.is_some() { + root + } else if left_found.is_some() { + left_found + } else if right_found.is_some() { + right_found + } else { + None + } + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_236() { + } +} diff --git a/src/problem/p0238_product_of_array_except_self.rs b/src/problem/p0238_product_of_array_except_self.rs new file mode 100644 index 00000000..d9043421 --- /dev/null +++ b/src/problem/p0238_product_of_array_except_self.rs @@ -0,0 +1,62 @@ +/** + * [238] Product of Array Except Self + * + * Given an integer array nums, return an array answer such that answer[i] is equal to the product of all the elements of nums except nums[i]. + * The product of any prefix or suffix of nums is guaranteed to fit in a 32-bit integer. + * You must write an algorithm that runs in O(n) time and without using the division operation. + * + * Example 1: + * Input: nums = [1,2,3,4] + * Output: [24,12,8,6] + * Example 2: + * Input: nums = [-1,1,0,-3,3] + * Output: [0,0,9,0,0] + * + * Constraints: + * + * 2 <= nums.length <= 10^5 + * -30 <= nums[i] <= 30 + * The product of any prefix or suffix of nums is guaranteed to fit in a 32-bit integer. + * + * + * Follow up: Can you solve the problem in O(1) extra space complexity? (The output array does not count as extra space for space complexity analysis.) + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/product-of-array-except-self/ +// discuss: https://leetcode.com/problems/product-of-array-except-self/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn product_except_self(nums: Vec) -> Vec { + let n : usize = nums.len(); + let mut result : Vec = vec![1;n]; + for (i, &num) in nums[0..(n-1)].iter().enumerate() { + result[i+1] = result[i] * num; + } + + let mut right : i32 = 1; + for (i, &num) in nums.iter().enumerate().rev() { + result[i] *= right; + right *= num + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_238() { + assert_eq!( + Solution::product_except_self(vec![1, 2, 3, 4]), + vec![24, 12, 8, 6] + ); + } +} diff --git a/src/problem/p0239_sliding_window_maximum.rs b/src/problem/p0239_sliding_window_maximum.rs new file mode 100644 index 00000000..d5d5e613 --- /dev/null +++ b/src/problem/p0239_sliding_window_maximum.rs @@ -0,0 +1,116 @@ +/** + * [239] Sliding Window Maximum + * + * You are given an array of integers nums, there is a sliding window of size k which is moving from the very left of the array to the very right. You can only see the k numbers in the window. Each time the sliding window moves right by one position. + * Return the max sliding window. + * + * Example 1: + * + * Input: nums = [1,3,-1,-3,5,3,6,7], k = 3 + * Output: [3,3,5,5,6,7] + * Explanation: + * Window position Max + * --------------- ----- + * [1 3 -1] -3 5 3 6 7 3 + * 1 [3 -1 -3] 5 3 6 7 3 + * 1 3 [-1 -3 5] 3 6 7 5 + * 1 3 -1 [-3 5 3] 6 7 5 + * 1 3 -1 -3 [5 3 6] 7 6 + * 1 3 -1 -3 5 [3 6 7] 7 + * + * Example 2: + * + * Input: nums = [1], k = 1 + * Output: [1] + * + * Example 3: + * + * Input: nums = [1,-1], k = 1 + * Output: [1,-1] + * + * Example 4: + * + * Input: nums = [9,11], k = 2 + * Output: [11] + * + * Example 5: + * + * Input: nums = [4,-2], k = 2 + * Output: [4] + * + * + * Constraints: + * + * 1 <= nums.length <= 10^5 + * -10^4 <= nums[i] <= 10^4 + * 1 <= k <= nums.length + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/sliding-window-maximum/ +// discuss: https://leetcode.com/problems/sliding-window-maximum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::BTreeMap; +impl Solution { + pub fn max_sliding_window(nums: Vec, k: i32) -> Vec { + let k = k as usize; + let mut num_count = BTreeMap::new(); + let mut result = vec![]; + for i in 0..k { + let num = nums[i]; + if let Some(count) = num_count.get_mut(&num) { + *count += 1; + } else { + num_count.insert(num, 1i32); + } + } + result.push(*num_count.iter().next_back().unwrap().0); + for i in k..nums.len() { + let num_to_decre = nums[i-k]; + *num_count.get_mut(&num_to_decre).unwrap()-=1; + if num_count[&num_to_decre] == 0 { + num_count.remove(&num_to_decre); + } + + + let num_to_incre = nums[i]; + + if let Some(count) = num_count.get_mut(&num_to_incre) { + *count += 1; + } else { + num_count.insert(num_to_incre, 1i32); + } + + result.push(*num_count.iter().next_back().unwrap().0); + + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_239() { + assert_eq!( + Solution::max_sliding_window(vec![9, 10, 9, -7, -4, -8, 2, -6], 5), + vec![10, 10, 9, 2] + ); + assert_eq!( + Solution::max_sliding_window(vec![1, 3, 1, 2, 0, 5], 3), + vec![3, 3, 2, 5] + ); + assert_eq!(Solution::max_sliding_window(vec![7, 2, 4], 2), vec![7, 4]); + assert_eq!(Solution::max_sliding_window(vec![1, -1], 1), vec![1, -1]); + assert_eq!( + Solution::max_sliding_window(vec![1, 3, -1, -3, 5, 3, 6, 7], 3), + vec![3, 3, 5, 5, 6, 7] + ); + } +} diff --git a/src/problem/p0240_search_a_2d_matrix_ii.rs b/src/problem/p0240_search_a_2d_matrix_ii.rs new file mode 100644 index 00000000..a4b52ab4 --- /dev/null +++ b/src/problem/p0240_search_a_2d_matrix_ii.rs @@ -0,0 +1,69 @@ +/** + * [240] Search a 2D Matrix II + * + * Write an efficient algorithm that searches for a target value in an m x n integer matrix. The matrix has the following properties: + * + * Integers in each row are sorted in ascending from left to right. + * Integers in each column are sorted in ascending from top to bottom. + * + * + * Example 1: + * + * Input: matrix = [[1,4,7,11,15],[2,5,8,12,19],[3,6,9,16,22],[10,13,14,17,24],[18,21,23,26,30]], target = 5 + * Output: true + * + * Example 2: + * + * Input: matrix = [[1,4,7,11,15],[2,5,8,12,19],[3,6,9,16,22],[10,13,14,17,24],[18,21,23,26,30]], target = 20 + * Output: false + * + * + * Constraints: + * + * m == matrix.length + * n == matrix[i].length + * 1 <= n, m <= 300 + * -10^9 <= matix[i][j] <= 10^9 + * All the integers in each row are sorted in ascending order. + * All the integers in each column are sorted in ascending order. + * -10^9 <= target <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/search-a-2d-matrix-ii/ +// discuss: https://leetcode.com/problems/search-a-2d-matrix-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn search_matrix(matrix: Vec>, target: i32) -> bool { + let mut i : i32 = 0; + let mut j : i32 = matrix[0].len() as i32 - 1; + let row_count : i32 = matrix.len() as i32; + + while i < row_count && j >= 0 { + let num : i32 = matrix[i as usize][j as usize]; + if num == target { + return true; + } else if num > target { + j-=1; + } else { + i+=1; + } + } + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_240() { + assert!(!Solution::search_matrix(vec![vec![-5]], -10)); + } +} diff --git a/src/problem/p0241_different_ways_to_add_parentheses.rs b/src/problem/p0241_different_ways_to_add_parentheses.rs new file mode 100644 index 00000000..ffac9a92 --- /dev/null +++ b/src/problem/p0241_different_ways_to_add_parentheses.rs @@ -0,0 +1,101 @@ +/** + * [241] Different Ways to Add Parentheses + * + * Given a string expression of numbers and operators, return all possible results from computing all the different possible ways to group numbers and operators. You may return the answer in any order. + * + * Example 1: + * + * Input: expression = "2-1-1" + * Output: [0,2] + * Explanation: + * ((2-1)-1) = 0 + * (2-(1-1)) = 2 + * + * Example 2: + * + * Input: expression = "2*3-4*5" + * Output: [-34,-14,-10,-10,10] + * Explanation: + * (2*(3-(4*5))) = -34 + * ((2*3)-(4*5)) = -14 + * ((2*(3-4))*5) = -10 + * (2*((3-4)*5)) = -10 + * (((2*3)-4)*5) = 10 + * + * + * Constraints: + * + * 1 <= expression.length <= 20 + * expression consists of digits and the operator '+', '-', and '*'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/different-ways-to-add-parentheses/ +// discuss: https://leetcode.com/problems/different-ways-to-add-parentheses/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn helper(expression : &Vec, start : usize, end : usize, cache : &mut HashMap<(usize, usize), Vec>) { + if let Some(cached) = cache.get(&(start, end)) { + return + } + + let mut result : Vec = vec![]; + let mut acc_num : i32 = 0; + for i in start..end { + let c : char = expression[i]; + if c == '+' || c == '-' || c == '*' { + Self::helper(expression, start, i, cache); + Self::helper(expression, i+1, end, cache); + + for &left_num in cache.get(&(start, i)).unwrap().iter() { + for &right_num in cache.get(&(i+1, end)).unwrap().iter() { + if c == '+' { + result.push(left_num + right_num); + } else if c == '-' { + result.push(left_num - right_num); + } else { + result.push(left_num * right_num); + } + } + } + } else { + acc_num = 10 * acc_num + (c as u8 - '0' as u8) as i32; + } + } + if result.len() == 0 { result.push(acc_num); } + // println!("start={}, end={}, result={:?}", start, end, result); + + cache.insert((start, end), result); + } + + pub fn diff_ways_to_compute(expression: String) -> Vec { + let expression : Vec = expression.chars().collect(); + let mut cache : HashMap<(usize, usize), Vec> = HashMap::new(); + let n : usize = expression.len(); + Self::helper(&expression, 0, n, &mut cache); + cache.get(&(0, n)).unwrap().clone() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_241() { + assert_eq!( + Solution::diff_ways_to_compute("2*3".to_owned()), + vec![6] + ); + + assert_eq!( + Solution::diff_ways_to_compute("2*3-4*5".to_owned()), + vec![-34, -10, -14, -10, 10] + ); + } +} diff --git a/src/problem/p0260_single_number_iii.rs b/src/problem/p0260_single_number_iii.rs new file mode 100644 index 00000000..3db5f7fc --- /dev/null +++ b/src/problem/p0260_single_number_iii.rs @@ -0,0 +1,64 @@ +/** + * [260] Single Number III + * + * Given an integer array nums, in which exactly two elements appear only once and all the other elements appear exactly twice. Find the two elements that appear only once. You can return the answer in any order. + * Follow up: Your algorithm should run in linear runtime complexity. Could you implement it using only constant space complexity? + * + * Example 1: + * + * Input: nums = [1,2,1,3,2,5] + * Output: [3,5] + * Explanation: [5, 3] is also a valid answer. + * + * Example 2: + * + * Input: nums = [-1,0] + * Output: [-1,0] + * + * Example 3: + * + * Input: nums = [0,1] + * Output: [1,0] + * + * + * Constraints: + * + * 2 <= nums.length <= 3 * 10^4 + * -2^31 <= nums[i] <= 2^31 - 1 + * Each integer in nums will appear twice, only two integers will appear once. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/single-number-iii/ +// discuss: https://leetcode.com/problems/single-number-iii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn single_number(nums: Vec) -> Vec { + // suppose two distinct numbers are a and b. + let axorb = nums.iter().fold(0, |acc, &x| {acc^x}); + // a, and b differ in this bit. + let last_set = axorb & -axorb; + // either a or b with the last_set-th bit 0 uniquely in this category + let num0 = nums.iter().filter(|x|{(**x & last_set)==0}).fold(0, |acc, &x|{acc^x}); + // either a or b with the last_set-th bit 1 uniquely in this category + let num1 = nums.iter().filter(|x|{(**x & last_set)!=0}).fold(0, |acc, &x|{acc^x}); + + vec![num0, num1] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_260() { + // assert_eq!(Solution::single_number(vec![1, 2, 1, 2, 3, 4]), vec![3, 4]); + assert_eq!(Solution::single_number(vec![1, 2, 1, 3, 2, 5]), vec![3, 5]); + } +} diff --git a/src/problem/p0264_ugly_number_ii.rs b/src/problem/p0264_ugly_number_ii.rs new file mode 100644 index 00000000..45883151 --- /dev/null +++ b/src/problem/p0264_ugly_number_ii.rs @@ -0,0 +1,69 @@ +/** + * [264] Ugly Number II + * + * An ugly number is a positive integer whose prime factors are limited to 2, 3, and 5. + * Given an integer n, return the n^th ugly number. + * + * Example 1: + * + * Input: n = 10 + * Output: 12 + * Explanation: [1, 2, 3, 4, 5, 6, 8, 9, 10, 12] is the sequence of the first 10 ugly numbers. + * + * Example 2: + * + * Input: n = 1 + * Output: 1 + * Explanation: 1 has no prime factors, therefore all of its prime factors are limited to 2, 3, and 5. + * + * + * Constraints: + * + * 1 <= n <= 1690 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/ugly-number-ii/ +// discuss: https://leetcode.com/problems/ugly-number-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn nth_ugly_number(n: i32) -> i32 { + // assume ugly[i] is the i-th ugly num, and ugly[0] = 1; + // Seperate ugly number into three lists: + // S2: ugly[0]*2, ugly[1]*2, ugly[2]*2, ..., ugly[l]*2 + // S3: ugly[0]*3, ugly[1]*3, ugly[2]*3, ..., ugly[m]*3 + // S5: ugly[0]*5, ugly[1]*5, ugly[2]*5, ..., ugly[p]*5 + + // Increment l,m and n, and merge the above three lists to get the ugly[n] + let n : usize = n as usize; + let mut ugly : Vec = vec![1;n]; + let mut l = 0usize; + let mut m = 0usize; + let mut p = 0usize; + + for i in 1..n { + ugly[i] = *[ugly[l]*2, ugly[m]*3, ugly[p]*5].iter().min().unwrap(); + if ugly[i] == ugly[l] * 2 {l+=1;} + if ugly[i] == ugly[m] * 3 {m+=1;} + if ugly[i] == ugly[p] * 5 {p+=1;} + } + ugly[n-1] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_264() { + // assert_eq!(Solution::nth_ugly_number(1), 1); + assert_eq!(Solution::nth_ugly_number(10), 12); + assert_eq!(Solution::nth_ugly_number(3), 3); + } +} diff --git a/src/problem/p0268_missing_number.rs b/src/problem/p0268_missing_number.rs new file mode 100644 index 00000000..827a2135 --- /dev/null +++ b/src/problem/p0268_missing_number.rs @@ -0,0 +1,64 @@ +/** + * [268] Missing Number + * + * Given an array nums containing n distinct numbers in the range [0, n], return the only number in the range that is missing from the array. + * Follow up: Could you implement a solution using only O(1) extra space complexity and O(n) runtime complexity? + * + * Example 1: + * + * Input: nums = [3,0,1] + * Output: 2 + * Explanation: n = 3 since there are 3 numbers, so all numbers are in the range [0,3]. 2 is the missing number in the range since it does not appear in nums. + * + * Example 2: + * + * Input: nums = [0,1] + * Output: 2 + * Explanation: n = 2 since there are 2 numbers, so all numbers are in the range [0,2]. 2 is the missing number in the range since it does not appear in nums. + * + * Example 3: + * + * Input: nums = [9,6,4,2,3,5,7,0,1] + * Output: 8 + * Explanation: n = 9 since there are 9 numbers, so all numbers are in the range [0,9]. 8 is the missing number in the range since it does not appear in nums. + * + * Example 4: + * + * Input: nums = [0] + * Output: 1 + * Explanation: n = 1 since there is 1 number, so all numbers are in the range [0,1]. 1 is the missing number in the range since it does not appear in nums. + * + * + * Constraints: + * + * n == nums.length + * 1 <= n <= 10^4 + * 0 <= nums[i] <= n + * All the numbers of nums are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/missing-number/ +// discuss: https://leetcode.com/problems/missing-number/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn missing_number(nums: Vec) -> i32 { + nums.iter().enumerate().fold(0, |acc,(i, x)|{acc^x^(i as i32)}) ^ (nums.len() as i32) + + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_268() { + assert_eq!(Solution::missing_number(vec![3, 0, 1]), 2); + } +} diff --git a/src/problem/p0273_integer_to_english_words.rs b/src/problem/p0273_integer_to_english_words.rs new file mode 100644 index 00000000..1dfd8e01 --- /dev/null +++ b/src/problem/p0273_integer_to_english_words.rs @@ -0,0 +1,107 @@ +/** + * [273] Integer to English Words + * + * Convert a non-negative integer num to its English words representation. + * + * Example 1: + * Input: num = 123 + * Output: "One Hundred Twenty Three" + * Example 2: + * Input: num = 12345 + * Output: "Twelve Thousand Three Hundred Forty Five" + * Example 3: + * Input: num = 1234567 + * Output: "One Million Two Hundred Thirty Four Thousand Five Hundred Sixty Seven" + * Example 4: + * Input: num = 1234567891 + * Output: "One Billion Two Hundred Thirty Four Million Five Hundred Sixty Seven Thousand Eight Hundred Ninety One" + * + * Constraints: + * + * 0 <= num <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/integer-to-english-words/ +// discuss: https://leetcode.com/problems/integer-to-english-words/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn number_to_words(num: i32) -> String { + if num == 0 {return "Zero".to_owned();} + let place_vals : Vec = vec![ + "".to_owned(), + "Thousand".to_owned(), + "Million".to_owned(), + "Billion".to_owned(), + // "Trillion".to_owned(), + // "Quadrillion".to_owned(), + // "Quintillion".to_owned(), + // "Hextillion".to_owned(), + // "Septillion".to_owned(), + // "Octillion".to_owned(), + // "Nonillion".to_owned(), + // "Decillion".to_owned(), + ]; + + let single_digits : Vec = vec!["".to_owned(), "One".to_owned(), "Two".to_owned(), "Three".to_owned(), + "Four".to_owned(), "Five".to_owned(), "Six".to_owned(), "Seven".to_owned(), + "Eight".to_owned(), "Nine".to_owned()]; + + let ten_pls : Vec = vec!["Ten".to_owned(), "Eleven".to_owned(), "Twelve".to_owned(), "Thirteen".to_owned(), + "Fourteen".to_owned(), "Fifteen".to_owned(), "Sixteen".to_owned(), "Seventeen".to_owned(), + "Eighteen".to_owned(), "Nineteen".to_owned()]; + + let double_digits: Vec = vec!["".to_owned(), "".to_owned(), "Twenty".to_owned(), "Thirty".to_owned(), + "Forty".to_owned(), "Fifty".to_owned(), "Sixty".to_owned(), "Seventy".to_owned(), + "Eighty".to_owned(), "Ninety".to_owned()]; + let mut words : Vec = vec![]; + for i in (0..(place_vals.len())).rev() { + let digit_part : usize = ((num / i32::pow(10, 3 * i as u32)) % 1000) as usize; + if digit_part == 0 {continue} + let digit2 = digit_part / 100 ; + let digit1 = digit_part / 10 % 10; + let digit0 = digit_part % 10 ; + + if digit2 !=0 { + words.push(single_digits[digit2].clone()); + words.push("Hundred".to_owned()); + } + if digit1 == 0 { + if digit0 != 0 { + words.push(single_digits[digit0].clone()); + } + } else if digit1 == 1 { + words.push(ten_pls[digit0].clone()); + } else { + words.push(double_digits[digit1].clone()); + if digit0 != 0 { + words.push(single_digits[digit0].clone()); + } + } + if i > 0 { + words.push(place_vals[i].clone()); + } + } + words.join(" ") + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_273() { + assert_eq!(Solution::number_to_words(1234567891), "One Billion Two Hundred Thirty Four Million Five Hundred Sixty Seven Thousand Eight Hundred Ninety One".to_owned()); + + assert_eq!(Solution::number_to_words(1234567), "One Million Two Hundred Thirty Four Thousand Five Hundred Sixty Seven".to_owned()); + + assert_eq!(Solution::number_to_words(12345), "Twelve Thousand Three Hundred Forty Five".to_owned()); + assert_eq!(Solution::number_to_words(50868), "Fifty Thousand Eight Hundred Sixty Eight".to_owned()); + } +} diff --git a/src/problem/p0274_h_index.rs b/src/problem/p0274_h_index.rs new file mode 100644 index 00000000..9bb5928e --- /dev/null +++ b/src/problem/p0274_h_index.rs @@ -0,0 +1,75 @@ +/** + * [274] H-Index + * + * Given an array of integers citations where citations[i] is the number of citations a researcher received for their i^th paper, return compute the researcher's h-index. + * According to the definition of h-index on Wikipedia: A scientist has an index h if h of their n papers have at least h citations each, and the other n - h papers have no more than h citations each. + * If there are several possible values for h, the maximum one is taken as the h-index. + * + * Example 1: + * + * Input: citations = [3,0,6,1,5] + * Output: 3 + * Explanation: [3,0,6,1,5] means the researcher has 5 papers in total and each of them had received 3, 0, 6, 1, 5 citations respectively. + * Since the researcher has 3 papers with at least 3 citations each and the remaining two with no more than 3 citations each, their h-index is 3. + * + * Example 2: + * + * Input: citations = [1,3,1] + * Output: 1 + * + * + * Constraints: + * + * n == citations.length + * 1 <= n <= 5000 + * 0 <= citations[i] <= 1000 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/h-index/ +// discuss: https://leetcode.com/problems/h-index/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::collections::BTreeMap; +impl Solution { + pub fn h_index(citations: Vec) -> i32 { + let mut citation_counts : Vec = vec![0;1001usize]; + for &citation in citations.iter() { + citation_counts[citation as usize] += 1; + } + + let mut last_h : usize = 0; + for c in (0..=1000).rev() { + let mut h : usize = last_h + citation_counts[c]; + if h <= c { + // h books has at least c citations => + // h books has at least h citations + last_h = h; + } else { + h = last_h; + while h < c { + h += 1; + } + return h as i32; + } + } + 0 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_274() { + assert_eq!(Solution::h_index(vec![3, 0, 6, 1, 5]), 3); + assert_eq!(Solution::h_index(vec![1, 3, 1]), 1); + assert_eq!(Solution::h_index(vec![1, 1]), 1); + assert_eq!(Solution::h_index(vec![0, 0, 4, 4]), 2); + } +} diff --git a/src/problem/p0275_h_index_ii.rs b/src/problem/p0275_h_index_ii.rs new file mode 100644 index 00000000..ad05abf7 --- /dev/null +++ b/src/problem/p0275_h_index_ii.rs @@ -0,0 +1,101 @@ +/** + * [275] H-Index II + * + * Given an array of integers citations where citations[i] is the number of citations a researcher received for their i^th paper and citations is sorted in an ascending order, return compute the researcher's h-index. + * According to the definition of h-index on Wikipedia: A scientist has an index h if h of their n papers have at least h citations each, and the other n - h papers have no more than h citations each. + * If there are several possible values for h, the maximum one is taken as the h-index. + * + * Example 1: + * + * Input: citations = [0,1,3,5,6] + * Output: 3 + * Explanation: [0,1,3,5,6] means the researcher has 5 papers in total and each of them had received 0, 1, 3, 5, 6 citations respectively. + * Since the researcher has 3 papers with at least 3 citations each and the remaining two with no more than 3 citations each, their h-index is 3. + * + * Example 2: + * + * Input: citations = [1,2,100] + * Output: 2 + * + * + * Constraints: + * + * n == citations.length + * 1 <= n <= 10^5 + * 0 <= citations[i] <= 1000 + * citations is sorted in ascending order. + * + * + * Follow up: Could you solve it in logarithmic time complexity? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/h-index-ii/ +// discuss: https://leetcode.com/problems/h-index-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn h_index(citations: Vec) -> i32 { + // find the smallest i such that citations[i] >= n-i,return n-i. + let mut left = 0i32; + let mut n = citations.len() as i32; + let mut right = n - 1; + while left <= right { + let mid : i32 = (left + right) / 2; + let h : i32 = n - mid; + if citations[mid as usize] >= h { + if mid == 0 || !(citations[mid as usize -1]>=h+1){ + return h; + } else { + // i can be smaller + right = mid - 1; + } + } else { + left = mid + 1; + } + } + 0 + } + + // pub fn h_index_2(citations: Vec) -> i32 { + // // if citations.len() == 0 { + // // return 0 + // // } else { + // // return Self::helper(&citations, 0, citations.len()); + // // } + // let mut low = 0; + // let mut high = citations.len(); + // let n = citations.len(); + // while low < high { + // let mid = (low + high) / 2; + // if n - mid == citations[mid] as usize { + // return (n - mid) as i32; + // } else if n - mid < citations[mid] as usize { + // high = mid; + // } else { + // low = mid + 1; + // } + // } + // return (n - low) as i32; + // } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_275() { + assert_eq!(Solution::h_index(vec![]), 0); + assert_eq!(Solution::h_index(vec![0]), 0); + assert_eq!(Solution::h_index(vec![11, 15]), 2); + assert_eq!(Solution::h_index(vec![1]), 1); + assert_eq!(Solution::h_index(vec![0, 1, 3, 5, 6]), 3); + assert_eq!(Solution::h_index(vec![0, 4, 4, 5, 6]), 4); + assert_eq!(Solution::h_index(vec![1, 2, 2, 2]), 2); + } +} diff --git a/src/problem/p0279_perfect_squares.rs b/src/problem/p0279_perfect_squares.rs new file mode 100644 index 00000000..27b9806a --- /dev/null +++ b/src/problem/p0279_perfect_squares.rs @@ -0,0 +1,62 @@ +/** + * [279] Perfect Squares + * + * Given an integer n, return the least number of perfect square numbers that sum to n. + * A perfect square is an integer that is the square of an integer; in other words, it is the product of some integer with itself. For example, 1, 4, 9, and 16 are perfect squares while 3 and 11 are not. + * + * Example 1: + * + * Input: n = 12 + * Output: 3 + * Explanation: 12 = 4 + 4 + 4. + * + * Example 2: + * + * Input: n = 13 + * Output: 2 + * Explanation: 13 = 4 + 9. + * + * + * Constraints: + * + * 1 <= n <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/perfect-squares/ +// discuss: https://leetcode.com/problems/perfect-squares/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn num_squares(n: i32) -> i32 { + let n : usize = n as usize; + // dp[i] denotes for the min number of square which sum to i. + let mut dp : Vec = vec![0;n+1]; + for i in 1..=n { + let mut j : usize = 1; + let mut prev_min : i32 = n as i32; + while j*j <= i { + prev_min = std::cmp::min(prev_min, dp[i-j*j]); + j+=1; + } + dp[i] = prev_min + 1; + } + + dp[n] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_279() { + assert_eq!(Solution::num_squares(13), 2); + assert_eq!(Solution::num_squares(12), 3); + } +} diff --git a/src/problem/p0282_expression_add_operators.rs b/src/problem/p0282_expression_add_operators.rs new file mode 100644 index 00000000..29722271 --- /dev/null +++ b/src/problem/p0282_expression_add_operators.rs @@ -0,0 +1,146 @@ +/** + * [282] Expression Add Operators + * + * Given a string num that contains only digits and an integer target, return all possibilities to add the binary operators '+', '-', or '*' between the digits of num so that the resultant expression evaluates to the target value. + * + * Example 1: + * Input: num = "123", target = 6 + * Output: ["1*2*3","1+2+3"] + * Example 2: + * Input: num = "232", target = 8 + * Output: ["2*3+2","2+3*2"] + * Example 3: + * Input: num = "105", target = 5 + * Output: ["1*0+5","10-5"] + * Example 4: + * Input: num = "00", target = 0 + * Output: ["0*0","0+0","0-0"] + * Example 5: + * Input: num = "3456237490", target = 9191 + * Output: [] + * + * Constraints: + * + * 1 <= num.length <= 10 + * num consists of only digits. + * -2^31 <= target <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/expression-add-operators/ +// discuss: https://leetcode.com/problems/expression-add-operators/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn backtrack(cur_ops : &mut Vec, results : &mut Vec, nums : &Vec, target : i32) { + let pad : String = (0..cur_ops.len()).map(|_|{" "}).collect(); + // println!("{}cur_opts={:?}",pad, cur_ops); + if cur_ops.len() == nums.len() - 1 { + let mut num_stack : Vec<(i32, char)> = vec![(nums[0], '+')]; + for i in 0..cur_ops.len() { + num_stack.push((nums[i+1], cur_ops[i])); + } + + let mut nospace_stack : Vec<(i32, char)> = vec![]; + for (&(num, op)) in num_stack.iter() { + if op == ' ' { + let (last_num, last_op) = nospace_stack.pop().unwrap(); + if last_num == 0 {return;} + if let Some(val) = 10i32.checked_mul(last_num) { + if let Some(new_num) = val.checked_add(num) { + nospace_stack.push((new_num, last_op)); + } else { + return; + } + } else { + return; + } + } else { + nospace_stack.push((num, op)); + } + } + + let mut nox_stack : Vec<(i32, char)> = vec![]; + for (&(num, op)) in nospace_stack.iter() { + if op == '*' { + let (last_num, last_op) = nox_stack.pop().unwrap(); + let new_num : i32 = last_num * num; + nox_stack.push((new_num, last_op)); + } else { + nox_stack.push((num, op)); + } + } + // println!(" {}num_stack:{:?}", pad, num_stack); + // println!(" {}nospace_stack:{:?}", pad, nospace_stack); + // println!(" {}nox_stack:{:?}", pad, nox_stack); + // println!(""); + + let mut cur_target : i32 = 0; + for (&(num, op)) in nox_stack.iter() { + if op == '+' { + cur_target += num; + } else { + cur_target -= num; + } + } + + if cur_target == target { + let mut result : String = String::from(nums[0].to_string()); + for i in 0..cur_ops.len() { + if cur_ops[i] != ' ' { + result.push(cur_ops[i]); + } + result.push_str(&nums[i+1].to_string()); + } + results.push(result); + } + return; + } + + let num_idx : usize = cur_ops.len() + 1; + + cur_ops.push('*'); + Self::backtrack(cur_ops, results, nums, target); + cur_ops.pop(); + + cur_ops.push(' '); + Self::backtrack(cur_ops, results, nums, target); + cur_ops.pop(); + + cur_ops.push('+'); + Self::backtrack(cur_ops, results, nums, target); + cur_ops.pop(); + + cur_ops.push('-'); + Self::backtrack(cur_ops, results, nums, target); + cur_ops.pop(); + + } + + + pub fn add_operators(num: String, target: i32) -> Vec { + let nums : Vec = num.chars().map(|v|{(v as u8 - '0' as u8) as i32}).collect(); + let mut cur_ops : Vec = vec![]; + let mut result : Vec = vec![]; + + Self::backtrack(&mut cur_ops, &mut result, &nums, target); + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_282() { + assert_eq!(Solution::add_operators("123".to_owned(), 6), vec!["1*2*3".to_owned(), "1+2+3".to_owned()]); + assert_eq!(Solution::add_operators("232".to_owned(), 8), vec!["2*3+2".to_owned(), "2+3*2".to_owned()]); + assert_eq!(Solution::add_operators("105".to_owned(), 5), vec!["1*0+5".to_owned(), "10-5".to_owned()]); + assert_eq!(Solution::add_operators("2147483648".to_owned(), -2147483648).len(), 0); + } +} diff --git a/src/problem/p0287_find_the_duplicate_number.rs b/src/problem/p0287_find_the_duplicate_number.rs new file mode 100644 index 00000000..ae862e9f --- /dev/null +++ b/src/problem/p0287_find_the_duplicate_number.rs @@ -0,0 +1,66 @@ +/** + * [287] Find the Duplicate Number + * + * Given an array of integers nums containing n + 1 integers where each integer is in the range [1, n] inclusive. + * There is only one repeated number in nums, return this repeated number. + * + * Example 1: + * Input: nums = [1,3,4,2,2] + * Output: 2 + * Example 2: + * Input: nums = [3,1,3,4,2] + * Output: 3 + * Example 3: + * Input: nums = [1,1] + * Output: 1 + * Example 4: + * Input: nums = [1,1,2] + * Output: 1 + * + * Constraints: + * + * 2 <= n <= 3 * 10^4 + * nums.length == n + 1 + * 1 <= nums[i] <= n + * All the integers in nums appear only once except for precisely one integer which appears two or more times. + * + * + * Follow up: + * + * How can we prove that at least one duplicate number must exist in nums? + * Can you solve the problem without modifying the array nums? + * Can you solve the problem using only constant, O(1) extra space? + * Can you solve the problem with runtime complexity less than O(n^2)? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/find-the-duplicate-number/ +// discuss: https://leetcode.com/problems/find-the-duplicate-number/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_duplicate(mut nums: Vec) -> i32 { + nums.sort(); + for i in 1..nums.len() { + if nums[i-1] == nums[i] {return nums[i-1];} + } + panic!("Can not reach here"); + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_287() { + assert_eq!(Solution::find_duplicate(vec![1, 3, 4, 2, 2]), 2); + assert_eq!(Solution::find_duplicate(vec![3, 1, 3, 4, 2]), 3); + assert_eq!(Solution::find_duplicate(vec![1, 2, 3, 4, 5, 5]), 5); + assert_eq!(Solution::find_duplicate(vec![5, 1, 2, 3, 4, 5]), 5); + } +} diff --git a/src/problem/p0289_game_of_life.rs b/src/problem/p0289_game_of_life.rs new file mode 100644 index 00000000..776ae2d8 --- /dev/null +++ b/src/problem/p0289_game_of_life.rs @@ -0,0 +1,124 @@ +/** + * [289] Game of Life + * + * According to Wikipedia's article: "The Game of Life, also known simply as Life, is a cellular automaton devised by the British mathematician John Horton Conway in 1970." + * The board is made up of an m x n grid of cells, where each cell has an initial state: live (represented by a 1) or dead (represented by a 0). Each cell interacts with its eight neighbors (horizontal, vertical, diagonal) using the following four rules (taken from the above Wikipedia article): + *
    + * Any live cell with fewer than two live neighbors dies as if caused by under-population. + * Any live cell with two or three live neighbors lives on to the next generation. + * Any live cell with more than three live neighbors dies, as if by over-population. + * Any dead cell with exactly three live neighbors becomes a live cell, as if by reproduction. + *
+ * The next state is created by applying the above rules simultaneously to every cell in the current state, where births and deaths occur simultaneously. Given the current state of the m x n grid board, return the next state. + * + * Example 1: + * + * Input: board = [[0,1,0],[0,0,1],[1,1,1],[0,0,0]] + * Output: [[0,0,0],[1,0,1],[0,1,1],[0,1,0]] + * + * Example 2: + * + * Input: board = [[1,1],[1,0]] + * Output: [[1,1],[1,1]] + * + * + * Constraints: + * + * m == board.length + * n == board[i].length + * 1 <= m, n <= 25 + * board[i][j] is 0 or 1. + * + * + * Follow up: + * + * Could you solve it in-place? Remember that the board needs to be updated simultaneously: You cannot update some cells first and then use their updated values to update other cells. + * In this question, we represent the board using a 2D array. In principle, the board is infinite, which would cause problems when the active area encroaches upon the border of the array (i.e., live cells reach the border). How would you address these problems? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/game-of-life/ +// discuss: https://leetcode.com/problems/game-of-life/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn game_of_life(board: &mut Vec>) { + let row_count : usize = board.len(); + let col_count : usize = board[0].len(); + + for i in 0..row_count { + for j in 0..col_count { + let mut live_count : usize = 0; + if 1 <= i && 1 <= j && board[i-1][j-1] & 0b1 == 1 { + live_count+=1; // left-up + } + + if 1 <= i && board[i-1][j] & 0b1 == 1 { + live_count+=1; // up + } + + if 1 <= i && j < col_count - 1 && board[i-1][j+1] & 0b1 == 1{ + live_count +=1; // right up + } + + if 1 <= j && board[i][j-1] & 0b1 == 1 { + live_count +=1; // left + } + + if j < col_count - 1 && board[i][j+1] & 0b1 == 1 { + live_count +=1; // right + } + + if i < row_count - 1 && 1 <= j && board[i+1][j-1] & 0b1 == 1 { + live_count+=1; // left-bottom + } + + if i < row_count - 1 && board[i+1][j] & 0b1 == 1 { + live_count+=1; // bottom + } + + if i < row_count - 1 && j < col_count - 1 && board[i+1][j+1] & 0b1 == 1{ + live_count +=1; // right bottom + } + + // println!("i={},j={},live_count={}",i,j,live_count); + if board[i][j] == 1 { + if live_count == 2 || live_count == 3 { + board[i][j] |= 0b10; + } + } else if live_count == 3 { + board[i][j] |= 0b10; + } + } + } + + for i in 0..row_count { + for j in 0..col_count { + if board[i][j] & 0b10 != 0 { + board[i][j] = 1; + } else { + board[i][j] = 0; + } + } + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_289() { + let mut test = vec![vec![0, 1, 0], vec![0, 0, 1], vec![1, 1, 1], vec![0, 0, 0]]; + Solution::game_of_life(&mut test); + assert_eq!( + test, + vec![vec![0, 0, 0], vec![1, 0, 1], vec![0, 1, 1], vec![0, 1, 0],] + ); + } +} diff --git a/src/problem/p0295_find_median_from_data_stream.rs b/src/problem/p0295_find_median_from_data_stream.rs new file mode 100644 index 00000000..a208289b --- /dev/null +++ b/src/problem/p0295_find_median_from_data_stream.rs @@ -0,0 +1,288 @@ +/** + * [295] Find Median from Data Stream + * + * The median is the middle value in an ordered integer list. If the size of the list is even, there is no middle value and the median is the mean of the two middle values. + * + * For example, for arr = [2,3,4], the median is 3. + * For example, for arr = [2,3], the median is (2 + 3) / 2 = 2.5. + * + * Implement the MedianFinder class: + * + * MedianFinder() initializes the MedianFinder object. + * void addNum(int num) adds the integer num from the data stream to the data structure. + * double findMedian() returns the median of all elements so far. Answers within 10^-5 of the actual answer will be accepted. + * + * + * Example 1: + * + * Input + * ["MedianFinder", "addNum", "addNum", "findMedian", "addNum", "findMedian"] + * [[], [1], [2], [], [3], []] + * Output + * [null, null, null, 1.5, null, 2.0] + * Explanation + * MedianFinder medianFinder = new MedianFinder(); + * medianFinder.addNum(1); // arr = [1] + * medianFinder.addNum(2); // arr = [1, 2] + * medianFinder.findMedian(); // return 1.5 (i.e., (1 + 2) / 2) + * medianFinder.addNum(3); // arr[1, 2, 3] + * medianFinder.findMedian(); // return 2.0 + * + * + * Constraints: + * + * -10^5 <= num <= 10^5 + * There will be at least one element in the data structure before calling findMedian. + * At most 5 * 10^4 calls will be made to addNum and findMedian. + * + * + * Follow up: + * + * If all integer numbers from the stream are in the range [0, 100], how would you optimize your solution? + * If 99% of all integer numbers from the stream are in the range [0, 100], how would you optimize your solution? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/find-median-from-data-stream/ +// discuss: https://leetcode.com/problems/find-median-from-data-stream/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use super::p0000_template::VecHeap; + +// use std::cmp::Ordering; +// use std::{collections::HashMap, hash::Hash}; +// #[derive(Debug)] +// struct VecHeap{ +// elements: Vec<(K,W,V)>, +// key2idx: HashMap, +// } + +// impl VecHeap{ +// pub fn new(keys: Vec, weights : Vec, values : Vec) -> VecHeap { +// let mut vh = VecHeap{elements: vec![], key2idx: HashMap::new()}; +// let n = keys.len(); +// for i in 0..keys.len() { +// let idx = vh.elements.len(); +// vh.key2idx.insert(keys[i].clone(), idx); +// vh.elements.push((keys[i].clone(), weights[i].clone(), values[i].clone())); +// } + +// for i in (0..(n/2)).rev() { +// vh.topdown_heapify(i, n); +// } + +// vh +// } + +// pub fn reweight_with_default(&mut self, key: &K, weight: &W, default_value: V) -> bool { +// if let Some((k,w,v)) = self.remove(key) { +// self.insert(k, weight.clone(),v); +// true +// } else { +// self.insert(key.clone(), weight.clone(),default_value); +// false +// } +// } + +// pub fn reweight(&mut self, key: &K, weight: &W) -> bool { +// if let Some((k,w,v)) = self.remove(key) { +// self.insert(k, weight.clone(),v); +// true +// } else { +// false +// } +// } + +// pub fn remove(&mut self, key : &K) -> Option<(K,W,V)> { +// if let Some(&removed_pos) = self.key2idx.get(key) { +// // swap the removed element with the last element. +// self.key2idx.remove(key); +// if removed_pos == self.elements.len() - 1 { +// self.elements.pop() +// } else { +// //swap the removed element wit the last. +// let removed = self.elements[removed_pos].clone(); +// let last_entry = self.elements.pop().unwrap(); +// self.key2idx.insert(last_entry.0.clone(), removed_pos); +// self.elements[removed_pos] = last_entry; + +// // topdown_heapify from the removed pos +// self.topdown_heapify(removed_pos, self.len()); +// Some(removed) +// } + +// } else { +// None +// } +// } + +// pub fn insert(&mut self, key: K, weight: W, value: V) { +// let last_pos = self.elements.len(); +// self.key2idx.insert(key.clone(), last_pos); +// self.elements.push((key, weight, value)); +// self.bottomup_heapify(last_pos) +// } + +// pub fn bottomup_heapify(&mut self, start_pos : usize) { +// if 0 < start_pos { +// let parent_pos = (start_pos + 1) / 2 - 1; +// if self.elements[parent_pos].1.cmp(&self.elements[start_pos].1) == Ordering::Less { +// self.elements.swap(parent_pos, start_pos); +// self.key2idx.insert(self.elements[start_pos].0.clone(), start_pos); +// self.key2idx.insert(self.elements[parent_pos].0.clone(), parent_pos); +// self.bottomup_heapify(parent_pos); +// } +// } +// } + +// pub fn topdown_heapify(&mut self, start_pos: usize, max_len: usize ) { +// let left_pos = 2 * start_pos + 1; +// let right_pos = 2 * (start_pos + 1); + +// let mut large_pos = None; +// let mut large_weight = self.elements[start_pos].1.clone(); +// if left_pos < max_len && large_weight.cmp(&self.elements[left_pos].1) == Ordering::Less { +// large_weight = self.elements[left_pos].1.clone(); +// large_pos = Some(left_pos); +// } + +// if right_pos < max_len && large_weight.cmp(&self.elements[right_pos].1) == Ordering::Less { +// large_weight = self.elements[right_pos].1.clone(); +// large_pos = Some(right_pos); +// } + +// if let Some(large_pos) = large_pos { +// self.elements.swap(start_pos, large_pos); +// self.key2idx.insert(self.elements[start_pos].0.clone(), start_pos); +// self.key2idx.insert(self.elements[large_pos].0.clone(), large_pos); + +// self.topdown_heapify(large_pos, max_len); +// } +// } + +// pub fn max(&self) -> Option<&(K,W,V)> { +// self.elements.get(0) +// } + +// pub fn len(&self) -> usize { +// self.elements.len() +// } + +// } + +struct MedianFinder { + first_half_max_heap : VecHeap, + sec_half_min_heap : VecHeap + } + + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl MedianFinder { + + /** initialize your data structure here. */ + fn new() -> Self { + MedianFinder{ + first_half_max_heap : VecHeap::new(vec![], vec![], vec![]), + sec_half_min_heap : VecHeap::new(vec![], vec![], vec![]) + } + } + + fn add_num(&mut self, num: i32) { + let first_half_len : usize = self.first_half_max_heap.len(); + let sec_half_len : usize = self.sec_half_min_heap.len(); + let num_id : usize = first_half_len + sec_half_len; // make each key distinct + + if first_half_len == sec_half_len { + self.first_half_max_heap.insert(num_id, num, num); + let &(first_half_greatest_id, _, first_half_greatest) = self.first_half_max_heap.max().unwrap(); + self.first_half_max_heap.remove(&first_half_greatest_id); + // println!("\tEVEN first_half_greatest: {}", first_half_greatest); + self.sec_half_min_heap.insert(first_half_greatest_id, -first_half_greatest, first_half_greatest); + } else { + self.sec_half_min_heap.insert(num_id, -num, num); + let &(sec_half_smallest_id, _, sec_half_smallest) = self.sec_half_min_heap.max().unwrap(); + + // println!("\tODD sec_half_smallest: {}", sec_half_smallest); + self.sec_half_min_heap.remove(&sec_half_smallest_id); + self.first_half_max_heap.insert(sec_half_smallest_id, sec_half_smallest, sec_half_smallest); + } + + // println!("\tFirst Half Max Heap LEN({}): {:?}", self.first_half_max_heap.len(), self.first_half_max_heap.elements); + // println!("\tSec Half Min Heap LEN({}): {:?}", self.sec_half_min_heap.len(), self.sec_half_min_heap.elements); + } + + fn find_median(&self) -> f64 { + let &(_, _, larger_mid) = self.sec_half_min_heap.max().unwrap(); + let &(_, _, smaller_mid) = self.sec_half_min_heap.max().unwrap(); + + if self.sec_half_min_heap.len() == self.first_half_max_heap.len() { + let &(_, _, smaller_mid) = self.first_half_max_heap.max().unwrap(); + // println!("\tEVEN smaller_mid = {}", smaller_mid); + // println!("\tEVEN larger_mid = {}", larger_mid); + (smaller_mid as f64 + larger_mid as f64) / 2.0 + } else { + // println!("\tODD smaller_mid = {}", smaller_mid); + // println!("\tODD larger_mid = {}", larger_mid); + (smaller_mid as f64 + larger_mid as f64) / 2.0 + } + } +} + +/** + * Your MedianFinder object will be instantiated and called as such: + * let obj = MedianFinder::new(); + * obj.add_num(num); + * let ret_2: f64 = obj.find_median(); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + + + #[test] + fn test_295() { + + fn helper(label : String, cmds : Vec, parameters : Vec, results : Vec) { + let mut mf = MedianFinder::new(); + for (i, cmd) in cmds.iter().enumerate() { + if cmd.eq("addNum") { + // println!("{} Add Num {}", i, parameters[i]); + mf.add_num(parameters[i]); + } else if cmd.eq("findMedian") { + // println!("{} FindMedian", i); + let actual : f64 = mf.find_median(); + let expected : f64 = results[i]; + if actual != results[i] { + panic!("label={}, i={}, mf.findMedian={}, result={}", label, i, actual, expected); + } + } + } + } + + helper("test1".to_owned(), vec!["addNum".to_owned(), "addNum".to_owned(), "findMedian".to_owned(), "addNum".to_owned(), "findMedian".to_owned()], vec![1,2,0,3,0], + vec![0.0,0.0,1.5, 0.0, 2.0]); + + let ops : Vec = ["MedianFinder","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian"].iter().map(|x|{String::from(*x)}).collect(); + let parameters : Vec = vec![vec![],vec![-1],vec![],vec![-2],vec![],vec![-3],vec![],vec![-4],vec![],vec![-5],vec![]].iter().map(|x|{if x.len() == 0 {0}else{x[0]}}).collect(); + let expected : Vec = vec![0.0,0.0,-1.00000,0.0,-1.50000,0.0,-2.00000,0.0,-2.50000,0.0,-3.00000]; + + helper("test2".to_owned(), ops, parameters, expected); + + let ops : Vec = ["MedianFinder","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian","addNum","findMedian"].iter().map(|x|{String::from(*x)}).collect(); + let parameters : Vec = vec![vec![],vec![78],vec![],vec![14],vec![],vec![50],vec![],vec![20],vec![],vec![13],vec![],vec![9],vec![],vec![25],vec![],vec![8],vec![],vec![13],vec![],vec![37],vec![],vec![29],vec![],vec![33],vec![],vec![55],vec![],vec![52],vec![],vec![6],vec![],vec![17],vec![],vec![65],vec![],vec![23],vec![],vec![74],vec![],vec![43],vec![],vec![5],vec![],vec![29],vec![],vec![29],vec![],vec![72],vec![],vec![7],vec![],vec![13],vec![],vec![56],vec![],vec![21],vec![],vec![31],vec![],vec![66],vec![],vec![69],vec![],vec![69],vec![],vec![74],vec![],vec![12],vec![],vec![77],vec![],vec![23],vec![],vec![10],vec![],vec![6],vec![],vec![27],vec![],vec![63],vec![],vec![77],vec![],vec![21],vec![],vec![40],vec![],vec![10],vec![],vec![19],vec![],vec![59],vec![],vec![35],vec![],vec![40],vec![],vec![44],vec![],vec![4],vec![],vec![15],vec![],vec![29],vec![],vec![63],vec![],vec![27],vec![],vec![46],vec![],vec![56],vec![],vec![0],vec![],vec![60],vec![],vec![72],vec![],vec![35],vec![],vec![54],vec![],vec![50],vec![],vec![14],vec![],vec![29],vec![],vec![62],vec![],vec![24],vec![],vec![18],vec![],vec![79],vec![],vec![16],vec![],vec![19],vec![],vec![8],vec![],vec![77],vec![],vec![10],vec![],vec![21],vec![],vec![66],vec![],vec![42],vec![],vec![76],vec![],vec![14],vec![],vec![58],vec![],vec![20],vec![],vec![0],vec![]].iter().map(|x|{if x.len() == 0 {0}else{x[0]}}).collect(); + + let expected : Vec = vec![0.0,0.0,78.00000,0.0,46.00000,0.0,50.00000,0.0,35.00000,0.0,20.00000,0.0,17.00000,0.0,20.00000,0.0,17.00000,0.0,14.00000,0.0,17.00000,0.0,20.00000,0.0,22.50000,0.0,25.00000,0.0,27.00000,0.0,25.00000,0.0,22.50000,0.0,25.00000,0.0,24.00000,0.0,25.00000,0.0,27.00000,0.0,25.00000,0.0,27.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,27.00000,0.0,29.00000,0.0,27.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,30.00000,0.0,31.00000,0.0,32.00000,0.0,31.00000,0.0,30.00000,0.0,31.00000,0.0,30.00000,0.0,29.00000,0.0,30.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000,0.0,29.00000]; + + helper("test3".to_owned(), ops, parameters, expected); + + } +} diff --git a/src/problem/p0297_serialize_and_deserialize_binary_tree.rs b/src/problem/p0297_serialize_and_deserialize_binary_tree.rs new file mode 100644 index 00000000..eafae38f --- /dev/null +++ b/src/problem/p0297_serialize_and_deserialize_binary_tree.rs @@ -0,0 +1,143 @@ +/** + * [297] Serialize and Deserialize Binary Tree + * + * Serialization is the process of converting a data structure or object into a sequence of bits so that it can be stored in a file or memory buffer, or transmitted across a network connection link to be reconstructed later in the same or another computer environment. + * Design an algorithm to serialize and deserialize a binary tree. There is no restriction on how your serialization/deserialization algorithm should work. You just need to ensure that a binary tree can be serialized to a string and this string can be deserialized to the original tree structure. + * Clarification: The input/output format is the same as how LeetCode serializes a binary tree. You do not necessarily need to follow this format, so please be creative and come up with different approaches yourself. + * + * Example 1: + * + * Input: root = [1,2,3,null,null,4,5] + * Output: [1,2,3,null,null,4,5] + * + * Example 2: + * + * Input: root = [] + * Output: [] + * + * Example 3: + * + * Input: root = [1] + * Output: [1] + * + * Example 4: + * + * Input: root = [1,2] + * Output: [1,2] + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [0, 10^4]. + * -1000 <= Node.val <= 1000 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/serialize-and-deserialize-binary-tree/ +// discuss: https://leetcode.com/problems/serialize-and-deserialize-binary-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::rc::Rc; +use std::cell::RefCell; +struct Codec { + +} + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl Codec { + fn new() -> Self { + Codec{} + } + + fn preorder_encode(node : &Option>>, encoded : &mut Vec) { + if node.is_none() { + encoded.push("X".to_owned()); + return; + } + let val_str : String = node.as_ref().unwrap().borrow().val.to_string(); + encoded.push(val_str); + + Self::preorder_encode(&node.as_ref().unwrap().borrow().left, encoded); + Self::preorder_encode(&node.as_ref().unwrap().borrow().right, encoded); + } + + fn serialize(&self, root: Option>>) -> String { + let mut encoded : Vec = vec![]; + Self::preorder_encode(&root, &mut encoded); + encoded.join("_") + } + + fn deserialize(&self, data: String) -> Option>> { + let encoded : Vec = data.split("_").map(|x|{x.to_owned()}).collect(); + Self::preorder_parse(&encoded, &mut 0usize) + } + + fn preorder_parse(encoded : &Vec, pos : &mut usize) ->Option>> { + if encoded[*pos].eq("X") { + *pos+=1; + return None; + } + let val : i32 = encoded[*pos].parse::().unwrap(); + *pos+=1; + let left_node : Option>> = Self::preorder_parse(&encoded, pos); + let right_node : Option>> = Self::preorder_parse(&encoded, pos); + let this_node : Rc> = Rc::new(RefCell::new(TreeNode::new(val))); + this_node.borrow_mut().left = left_node; + this_node.borrow_mut().right = right_node; + Some(this_node) + } +} + +/** + * Your Codec object will be instantiated and called as such: + * let obj = Codec::new(); + * let data: String = obj.serialize(strs); + * let ans: Option>> = obj.deserialize(data); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_297() { + let codec = Codec{}; + let expected : String = "1_2_X_X_3_4_X_X_5_X_X".to_owned(); + let tree : Option>> = tree![1,2,3,null,null,4,5]; + assert_eq!(codec.serialize(tree), expected.to_owned()); + let tree : Option>> = tree![1,2,3,null,null,4,5]; + assert_eq!(codec.deserialize(expected), tree); + + let expected : String = "X".to_owned(); + let tree : Option>> = tree![]; + assert_eq!(codec.serialize(tree), expected.to_owned()); + let tree : Option>> = tree![]; + assert_eq!(codec.deserialize(expected), tree); + } +} diff --git a/src/problem/p0299_bulls_and_cows.rs b/src/problem/p0299_bulls_and_cows.rs new file mode 100644 index 00000000..f317974e --- /dev/null +++ b/src/problem/p0299_bulls_and_cows.rs @@ -0,0 +1,104 @@ +/** + * [299] Bulls and Cows + * + * You are playing the Bulls and Cows game with your friend. + * You write down a secret number and ask your friend to guess what the number is. When your friend makes a guess, you provide a hint with the following info: + * + * The number of "bulls", which are digits in the guess that are in the correct position. + * The number of "cows", which are digits in the guess that are in your secret number but are located in the wrong position. Specifically, the non-bull digits in the guess that could be rearranged such that they become bulls. + * + * Given the secret number secret and your friend's guess guess, return the hint for your friend's guess. + * The hint should be formatted as "xAyB", where x is the number of bulls and y is the number of cows. Note that both secret and guess may contain duplicate digits. + * + * Example 1: + * + * Input: secret = "1807", guess = "7810" + * Output: "1A3B" + * Explanation: Bulls are connected with a '|' and cows are underlined: + * "1807" + * | + * "7810" + * Example 2: + * + * Input: secret = "1123", guess = "0111" + * Output: "1A1B" + * Explanation: Bulls are connected with a '|' and cows are underlined: + * "1123" "1123" + * | or | + * "0111" "0111" + * Note that only one of the two unmatched 1s is counted as a cow since the non-bull digits can only be rearranged to allow one 1 to be a bull. + * + * Example 3: + * + * Input: secret = "1", guess = "0" + * Output: "0A0B" + * + * Example 4: + * + * Input: secret = "1", guess = "1" + * Output: "1A0B" + * + * + * Constraints: + * + * 1 <= secret.length, guess.length <= 1000 + * secret.length == guess.length + * secret and guess consist of digits only. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/bulls-and-cows/ +// discuss: https://leetcode.com/problems/bulls-and-cows/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn get_hint(secret: String, guess: String) -> String { + let mut secret_digit_count : Vec = vec![0;10]; + let mut guess_digit_count : Vec = vec![0;10]; + + for c in secret.chars() { + secret_digit_count[(c as u8 - '0' as u8) as usize] += 1; + } + + for c in guess.chars() { + guess_digit_count[(c as u8 - '0' as u8) as usize] += 1; + } + let secret : Vec = secret.chars().rev().collect(); + let mut bull_count : usize = 0; + for (i, c) in guess.chars().rev().enumerate() { + if secret[i] == c { + bull_count +=1; + let c_digit : usize = (c as u8 - '0' as u8) as usize; + secret_digit_count[c_digit]-=1; + guess_digit_count[c_digit]-=1; + } + } + + let mut cow_count : usize = 0; + for i in 0..=9 { + cow_count += std::cmp::min(secret_digit_count[i], guess_digit_count[i]); + } + format!("{}A{}B", bull_count, cow_count).to_owned() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_299() { + assert_eq!( + Solution::get_hint("1807".to_owned(), "7810".to_owned()), + "1A3B".to_owned() + ); + assert_eq!( + Solution::get_hint("1123".to_owned(), "0111".to_owned()), + "1A1B".to_owned() + ); + } +} diff --git a/src/problem/p0300_longest_increasing_subsequence.rs b/src/problem/p0300_longest_increasing_subsequence.rs new file mode 100644 index 00000000..a3fb4f61 --- /dev/null +++ b/src/problem/p0300_longest_increasing_subsequence.rs @@ -0,0 +1,102 @@ +/** + * [300] Longest Increasing Subsequence + * + * Given an integer array nums, return the length of the longest strictly increasing subsequence. + * A subsequence is a sequence that can be derived from an array by deleting some or no elements without changing the order of the remaining elements. For example, [3,6,2,7] is a subsequence of the array [0,3,1,6,2,2,7]. + * + * Example 1: + * + * Input: nums = [10,9,2,5,3,7,101,18] + * Output: 4 + * Explanation: The longest increasing subsequence is [2,3,7,101], therefore the length is 4. + * + * Example 2: + * + * Input: nums = [0,1,0,3,2,3] + * Output: 4 + * + * Example 3: + * + * Input: nums = [7,7,7,7,7,7,7] + * Output: 1 + * + * + * Constraints: + * + * 1 <= nums.length <= 2500 + * -10^4 <= nums[i] <= 10^4 + * + * + * Follow up: + * + * Could you come up with the O(n^2) solution? + * Could you improve it to O(n log(n)) time complexity? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/longest-increasing-subsequence/ +// discuss: https://leetcode.com/problems/longest-increasing-subsequence/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_last_list_index_with_smaller_end(lises : &Vec>, target : i32) -> i32 { + let mut low = 0i32; + let mut high = lises.len() as i32 - 1; + let n = lises.len() as i32; + while low <= high { + let mid = ((low + high) / 2) as usize; + let mid_num = *lises[mid].last().unwrap(); + // println!("low={}, high={}, mid={}, mid_num={}", low, high, mid, mid_num); + if mid_num < target { + if mid as i32 == (n-1) || !(*lises[mid+1].last().unwrap() < target) { + return mid as i32; + } else { + low = mid as i32 + 1; + } + } else { + high = mid as i32 - 1; + } + } + -1 // not found. + } + + pub fn length_of_lis(nums: Vec) -> i32 { + // lises[i] maintains the longest increasing subsequent of length i, known so far. + let mut lises = vec![]; + for &num in nums.iter() { + let l = Self::find_last_list_index_with_smaller_end(&lises, num); + let mut new_list : Vec = vec![]; + if l != -1 { + new_list = lises[l as usize].clone(); + } + new_list.push(num); + // println!("num={}, l={}, new_list={:?}", num, l, new_list); + // println!("lises={:?}", lises); + // println!("========================================="); + let insert_idx = (l + 1) as usize; + if insert_idx < lises.len() { + lises[insert_idx] = new_list; + } else if insert_idx == lises.len() { + lises.push(new_list); + } else { + panic!("Impossible..."); + } + } + // println!("lis={:?}", *lises.last().unwrap()); + lises.last().unwrap().len() as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_300() { + assert_eq!(Solution::length_of_lis(vec![10, 9, 2, 5, 3, 7, 101, 18]), 4); + } +} diff --git a/src/problem/p0301_remove_invalid_parentheses.rs b/src/problem/p0301_remove_invalid_parentheses.rs new file mode 100644 index 00000000..53fc5b2a --- /dev/null +++ b/src/problem/p0301_remove_invalid_parentheses.rs @@ -0,0 +1,127 @@ +/** + * [301] Remove Invalid Parentheses + * + * Given a string s that contains parentheses and letters, remove the minimum number of invalid parentheses to make the input string valid. + * Return all the possible results. You may return the answer in any order. + * + * Example 1: + * + * Input: s = "()())()" + * Output: ["(())()","()()()"] + * + * Example 2: + * + * Input: s = "(a)())()" + * Output: ["(a())()","(a)()()"] + * + * Example 3: + * + * Input: s = ")(" + * Output: [""] + * + * + * Constraints: + * + * 1 <= s.length <= 25 + * s consists of lowercase English letters and parentheses '(' and ')'. + * There will be at most 20 parentheses in s. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/remove-invalid-parentheses/ +// discuss: https://leetcode.com/problems/remove-invalid-parentheses/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn remove(s : &Vec, results : &mut Vec, tmp_selected:&Vec, cur_pos: usize, last_removed_pos : usize, char_to_push : char, char_to_pop : char, level : usize) { + let pad : String = (0..level).map(|_|{" "}).collect(); + // println!("{}tmp_selected:{:?}, cur_pos={}, last_removed_pos={}", pad, tmp_selected, cur_pos, last_removed_pos); + let n : usize = s.len(); + let mut unmatched_count : usize = 0; + let mut cur_selected : Vec = tmp_selected.clone(); + for i in cur_pos..n { + cur_selected.push(i); + + if s[i] == char_to_push { + unmatched_count += 1; + } else if s[i] == char_to_pop && unmatched_count != 0 { + unmatched_count -=1; + } else if s[i] == char_to_pop && unmatched_count == 0 { + // remove a char_to_pop among selected, avoid duplicates. + for (pos_idx, &selected_pos) in cur_selected.iter().enumerate() { + let mut valid_removed_pos = false;; + + if selected_pos >= last_removed_pos && s[selected_pos] == char_to_pop { + if pos_idx == 0 { + valid_removed_pos = true; + } else if s[cur_selected[pos_idx-1]] != char_to_pop { + valid_removed_pos = true; + } else if cur_selected[pos_idx-1] < last_removed_pos { + valid_removed_pos = true; + } + } + // println!("{}pos_idx={}, selected_pos={}, valid_to_remove={}", pad, pos_idx, selected_pos, valid_removed_pos); + + if valid_removed_pos { + let next_selected : Vec = cur_selected.iter().enumerate().filter(|&(idx, _)|{idx != pos_idx}).map(|(_, &pos)|{pos}).collect(); + Self::remove(s, results, &next_selected, i+1, selected_pos, char_to_push, char_to_pop, level + 1); + } + } + return; + } + } + + let result : String = cur_selected.iter().map(|&pos|{s[pos]}).collect(); + results.push(result); + + } + + pub fn remove_invalid_parentheses(s: String) -> Vec { + let s : Vec = s.chars().collect(); + let mut forward_results : Vec = vec![]; + let tmp_selected : Vec = vec![]; + Self::remove(&s, &mut forward_results, &tmp_selected, 0, 0, '(',')', 0); + + let mut backward_results : Vec = vec![]; + for forward_result in forward_results.iter() { + let reversed : Vec = forward_result.chars().rev().collect(); + Self::remove(&reversed, &mut backward_results, &tmp_selected, 0, 0, ')', '(', 0); + } + + backward_results.iter().map(|x|{x.chars().rev().collect::()}).collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_301() { + assert_eq!( + Solution::remove_invalid_parentheses("()())()".to_owned()), + vec_string!["(())()", "()()()"] + ); + assert_eq!( + Solution::remove_invalid_parentheses("(a)())()".to_owned()), + vec_string!["(a())()", "(a)()()"] + ); + assert_eq!( + Solution::remove_invalid_parentheses(")(".to_owned()), + vec_string![""] + ); + assert_eq!( + Solution::remove_invalid_parentheses("))".to_owned()), + vec_string![""] + ); + + assert_eq!( + Solution::remove_invalid_parentheses(")d))".to_owned()), + vec_string!["d"] + ); + } +} diff --git a/src/problem/p0304_range_sum_query_2d_immutable.rs b/src/problem/p0304_range_sum_query_2d_immutable.rs new file mode 100644 index 00000000..6bf9398e --- /dev/null +++ b/src/problem/p0304_range_sum_query_2d_immutable.rs @@ -0,0 +1,117 @@ +/** + * [304] Range Sum Query 2D - Immutable + * + * Given a 2D matrix matrix, handle multiple queries of the following type: + *
    + * Calculate the sum of the elements of matrix inside the rectangle defined by its upper left corner (row1, col1) and lower right corner (row2, col2). + *
+ * Implement the NumMatrix class: + * + * NumMatrix(int[][] matrix) Initializes the object with the integer matrix matrix. + * int sumRegion(int row1, int col1, int row2, int col2) Returns the sum of the elements of matrix inside the rectangle defined by its upper left corner (row1, col1) and lower right corner (row2, col2). + * + * + * Example 1: + * + * Input + * ["NumMatrix", "sumRegion", "sumRegion", "sumRegion"] + * [[[[3, 0, 1, 4, 2], [5, 6, 3, 2, 1], [1, 2, 0, 1, 5], [4, 1, 0, 1, 7], [1, 0, 3, 0, 5]]], [2, 1, 4, 3], [1, 1, 2, 2], [1, 2, 2, 4]] + * Output + * [null, 8, 11, 12] + * Explanation + * NumMatrix numMatrix = new NumMatrix([[3, 0, 1, 4, 2], [5, 6, 3, 2, 1], [1, 2, 0, 1, 5], [4, 1, 0, 1, 7], [1, 0, 3, 0, 5]]); + * numMatrix.sumRegion(2, 1, 4, 3); // return 8 (i.e sum of the red rectangle) + * numMatrix.sumRegion(1, 1, 2, 2); // return 11 (i.e sum of the green rectangle) + * numMatrix.sumRegion(1, 2, 2, 4); // return 12 (i.e sum of the blue rectangle) + * + * + * Constraints: + * + * m == matrix.length + * n == matrix[i].length + * 1 <= m, n <= 200 + * -10^5 <= matrix[i][j] <= 10^5 + * 0 <= row1 <= row2 < m + * 0 <= col1 <= col2 < n + * At most 10^4 calls will be made to sumRegion. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/range-sum-query-2d-immutable/ +// discuss: https://leetcode.com/problems/range-sum-query-2d-immutable/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +struct NumMatrix { + prefix_sum : Vec>, +} + + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl NumMatrix { + + fn new(matrix: Vec>) -> Self { + let row_count : usize = matrix.len(); + let col_count : usize = matrix[0].len(); + + let mut prev_col_sums : Vec = vec![0;col_count]; + let mut prefix_sum : Vec> = matrix.clone(); + for i in 0..row_count { + let mut row_sum : i32 = 0; + for j in 0..col_count { + row_sum += matrix[i][j]; + prev_col_sums[j] += row_sum; + prefix_sum[i][j] = prev_col_sums[j]; + } + } + Self{prefix_sum: prefix_sum} + } + + fn value(&self, row : i32, col : i32) -> i32 { + self.prefix_sum[row as usize][col as usize] + } + + fn sum_region(&self, row1: i32, col1: i32, row2: i32, col2: i32) -> i32 { + let mut left_upper_sum : i32 = 0; + if 0 < row1 && 0 < col1 { + left_upper_sum = self.value(row1-1, col1-1) + } + + let mut left_lower_sum : i32 = 0; + if 0 < col1 { + left_lower_sum = self.value(row2, col1-1); + } + + let mut right_upper_sum : i32 = 0; + if 0 < row1 { + right_upper_sum = self.value(row1-1, col2); + } + + self.value(row2, col2) - right_upper_sum - left_lower_sum + left_upper_sum + } +} + +/** + * Your NumMatrix object will be instantiated and called as such: + * let obj = NumMatrix::new(matrix); + * let ret_1: i32 = obj.sum_region(row1, col1, row2, col2); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_304() { + let matrix : NumMatrix = NumMatrix::new(vec![vec![3, 0, 1, 4, 2], vec![5, 6, 3, 2, 1], vec![1, 2, 0, 1, 5], vec![4, 1, 0, 1, 7], vec![1, 0, 3, 0, 5]]); + assert_eq!(matrix.sum_region(2, 1, 4, 3), 8); + assert_eq!(matrix.sum_region(1, 1, 2, 2), 11); + assert_eq!(matrix.sum_region(1, 2, 2, 4), 12); + } +} diff --git a/src/problem/p0306_additive_number.rs b/src/problem/p0306_additive_number.rs new file mode 100644 index 00000000..9a2f519d --- /dev/null +++ b/src/problem/p0306_additive_number.rs @@ -0,0 +1,116 @@ +/** + * [306] Additive Number + * + * Additive number is a string whose digits can form additive sequence. + * A valid additive sequence should contain at least three numbers. Except for the first two numbers, each subsequent number in the sequence must be the sum of the preceding two. + * Given a string containing only digits '0'-'9', write a function to determine if it's an additive number. + * Note: Numbers in the additive sequence cannot have leading zeros, so sequence 1, 2, 03 or 1, 02, 3 is invalid. + * + * Example 1: + * + * Input: "112358" + * Output: true + * Explanation: The digits can form an additive sequence: 1, 1, 2, 3, 5, 8. + * 1 + 1 = 2, 1 + 2 = 3, 2 + 3 = 5, 3 + 5 = 8 + * + * Example 2: + * + * Input: "199100199" + * Output: true + * Explanation: The additive sequence is: 1, 99, 100, 199. + * 1 + 99 = 100, 99 + 100 = 199 + * + * + * Constraints: + * + * num consists only of digits '0'-'9'. + * 1 <= num.length <= 35 + * + * Follow up:
+ * How would you handle overflow for very large input integers? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/additive-number/ +// discuss: https://leetcode.com/problems/additive-number/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn digits2num(digits : &Vec, start : usize, end : usize) -> i64 { + let mut num : i64 = 0; + for i in start..=end { + num = 10 * num + (digits[i] as u8 - '0' as u8) as i64; + } + num + } + pub fn helper(digits : &Vec, cur_pos : usize, tmp : &mut Vec) -> bool { + let digit_len : usize = digits.len(); + if cur_pos == digit_len { + return tmp.len() >= 3; + } + let mut leading_zero : bool = false; + if digits[cur_pos] == '0' { leading_zero = true; } + + if tmp.len() == 0 || tmp.len() == 1 { + for end_pos in cur_pos..digit_len { + if leading_zero && end_pos > cur_pos { break; } + + let num : i64 = Self::digits2num(&digits, cur_pos, end_pos); + tmp.push(num); + if Self::helper(&digits, end_pos+1, tmp) { + return true; + } else { + tmp.pop(); + } + } + false + } else { + let target_sum : i64 = tmp[tmp.len() - 1] + tmp[tmp.len() - 2]; + let mut end_pos : usize = cur_pos; + let mut num : i64 = (digits[end_pos] as u8 - '0' as u8) as i64; + + while !leading_zero && num < target_sum && end_pos+1 < digit_len { + end_pos+=1; + num = 10 * num + (digits[end_pos] as u8 - '0' as u8) as i64; + } + + if num < target_sum { + // out of digits; + false + } else if num == target_sum { + tmp.push(num); + let result = Self::helper(&digits, end_pos + 1, tmp); + tmp.pop(); + result + } else { + false + } + } + } + + pub fn is_additive_number(num: String) -> bool { + let digits : Vec = num.chars().collect(); + let mut tmp : Vec = vec![]; + Self::helper(&digits, 0, &mut tmp) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_306() { + // assert_eq!(Solution::is_additive_number("112358".to_owned()), true); + // assert_eq!(Solution::is_additive_number("199100199".to_owned()), true); + // assert_eq!(Solution::is_additive_number("1991001990".to_owned()), false); + // assert_eq!(Solution::is_additive_number("1023".to_owned()), false); + + // assert_eq!(Solution::is_additive_number("101".to_owned()), true); + assert_eq!(Solution::is_additive_number("121474836472147483648".to_owned()), true); + } +} diff --git a/src/problem/p0307_range_sum_query_mutable.rs b/src/problem/p0307_range_sum_query_mutable.rs new file mode 100644 index 00000000..18ae0b34 --- /dev/null +++ b/src/problem/p0307_range_sum_query_mutable.rs @@ -0,0 +1,188 @@ +/** + * [307] Range Sum Query - Mutable + * + * Given an integer array nums, handle multiple queries of the following types: + *
    + * Update the value of an element in nums. + * Calculate the sum of the elements of nums between indices left and right inclusive where left <= right. + *
+ * Implement the NumArray class: + * + * NumArray(int[] nums) Initializes the object with the integer array nums. + * void update(int index, int val) Updates the value of nums[index] to be val. + * int sumRange(int left, int right) Returns the sum of the elements of nums between indices left and right inclusive (i.e. nums[left] + nums[left + 1] + ... + nums[right]). + * + * + * Example 1: + * + * Input + * ["NumArray", "sumRange", "update", "sumRange"] + * [[[1, 3, 5]], [0, 2], [1, 2], [0, 2]] + * Output + * [null, 9, null, 8] + * Explanation + * NumArray numArray = new NumArray([1, 3, 5]); + * numArray.sumRange(0, 2); // return 1 + 3 + 5 = 9 + * numArray.update(1, 2); // nums = [1, 2, 5] + * numArray.sumRange(0, 2); // return 1 + 2 + 5 = 8 + * + * + * Constraints: + * + * 1 <= nums.length <= 3 * 10^4 + * -100 <= nums[i] <= 100 + * 0 <= index < nums.length + * -100 <= val <= 100 + * 0 <= left <= right < nums.length + * At most 3 * 10^4 calls will be made to update and sumRange. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/range-sum-query-mutable/ +// discuss: https://leetcode.com/problems/range-sum-query-mutable/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +struct NumArray(Vec); + +impl NumArray { + + fn new(nums: Vec) -> Self { + let l : usize = nums.len(); + let mut na : Self = Self(vec![0;l+1]); + for (i, &num) in nums.iter().enumerate() { + na.increment(i as i32, num); + } + + na + } + + fn update(&mut self, index: i32, val: i32) { + let old = self.get(index); + let inc : i32 = val - old; + self.increment(index, inc); + } + + fn increment(&mut self, index: i32, incr: i32) { + self.increment_inner(index+1, incr); + } + + fn sum_query(&self, idx : i32 ) -> i32 { + self.sum_query_inner(idx+1) + } + + + fn sum_range(&self, left: i32, right: i32) -> i32 { + if left == 0 { + self.sum_query(right) + } else { + self.sum_query(right) - self.sum_query(left-1) + } + } + + fn get(&self, idx : i32) -> i32 { + // self.sum_range(idx, idx) + self.get_inner(idx+1) + } + + fn inner(&self) -> Vec { + self.0.clone() + } + + fn get_inner(&self, mut idx : i32) -> i32 { + let mut sum : i32 = self.0[idx as usize]; + let idx_no_ls1b : i32 = idx & (idx - 1); + idx-=1; + while idx != idx_no_ls1b { + sum -= self.0[idx as usize]; + idx &= (idx-1); + } + sum + } + + // inner function assumes index starting from 0. + fn increment_inner(&mut self, mut index: i32, incr: i32) { + while (index as usize) < self.0.len() { + self.0[index as usize] += incr; + index += index & -index; + } + } + + fn sum_query_inner(&self, mut idx : i32 ) -> i32 { + let mut sum : i32 = 0; + while 0 < idx { + sum += self.0[idx as usize]; + idx &=(idx-1); + } + sum + } + + // Assume non-negative elements + fn last_idx_prefix_sum_le(&self, mut target : i32) -> i32 { + // the MSB of index. + let mut bit_mask : i32 = self.0.len() as i32- 1; + bit_mask = bit_mask | (bit_mask >> 1); + bit_mask = bit_mask | (bit_mask >> 2); + bit_mask = bit_mask | (bit_mask >> 4); + bit_mask = bit_mask | (bit_mask >> 8); + bit_mask = bit_mask | (bit_mask >> 16); + bit_mask = (bit_mask+1)>>1; + + let mut base_idx : usize = 0; + while bit_mask != 0 { + let idx : usize = base_idx + bit_mask as usize; + bit_mask >>= 1; + if idx >= self.0.len() {continue;} + if self.0[idx] <= target { + target -= self.0[idx]; + base_idx = idx; + } + } + if target == 0 { + // find an equal case + } else { + // println!("target={}", target); + // find an less than case. + } + base_idx as i32 - 1 + } + +} + +/** + * Your NumArray object will be instantiated and called as such: + * let obj = NumArray::new(nums); + * obj.update(index, val); + * let ret_2: i32 = obj.sum_range(left, right); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_307() { + let _empty = NumArray::new(vec![]); + let mut tree = NumArray::new(vec![1, 1, 1, 1, 1, 1, 1, 1, 1, 1]); + assert_eq!(tree.sum_range(0, 6), 7); + assert_eq!(tree.last_idx_prefix_sum_le(7), 6); + assert_eq!(tree.last_idx_prefix_sum_le(17), 9); + + tree.update(0, 2); + + assert_eq!(tree.sum_range(0, 6), 8); + assert_eq!(tree.get(0), 2); + + tree.update(1, 2); + assert_eq!(tree.last_idx_prefix_sum_le(4), 1); + assert_eq!(tree.sum_range(0, 2), 5); + + tree.update(6, 10); + assert_eq!(tree.last_idx_prefix_sum_le(16), 5); + assert_eq!(tree.last_idx_prefix_sum_le(18), 6); + assert_eq!(tree.sum_range(6, 6), 10); + } +} diff --git a/src/problem/p0309_best_time_to_buy_and_sell_stock_with_cooldown.rs b/src/problem/p0309_best_time_to_buy_and_sell_stock_with_cooldown.rs new file mode 100644 index 00000000..bfaec976 --- /dev/null +++ b/src/problem/p0309_best_time_to_buy_and_sell_stock_with_cooldown.rs @@ -0,0 +1,88 @@ +/** + * [309] Best Time to Buy and Sell Stock with Cooldown + * + * You are given an array prices where prices[i] is the price of a given stock on the i^th day. + * Find the maximum profit you can achieve. You may complete as many transactions as you like (i.e., buy one and sell one share of the stock multiple times) with the following restrictions: + * + * After you sell your stock, you cannot buy stock on the next day (i.e., cooldown one day). + * + * Note: You may not engage in multiple transactions simultaneously (i.e., you must sell the stock before you buy again). + * + * Example 1: + * + * Input: prices = [1,2,3,0,2] + * Output: 3 + * Explanation: transactions = [buy, sell, cooldown, buy, sell] + * + * Example 2: + * + * Input: prices = [1] + * Output: 0 + * + * + * Constraints: + * + * 1 <= prices.length <= 5000 + * 0 <= prices[i] <= 1000 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/best-time-to-buy-and-sell-stock-with-cooldown/ +// discuss: https://leetcode.com/problems/best-time-to-buy-and-sell-stock-with-cooldown/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn max_profit(prices: Vec) -> i32 { + let mut last_no_stock_balance : i32 = 0; + let mut last_with_stock_balance : i32 = -2_147_483_648i32; + let mut sec_last_no_stock_balance : i32 = 0; + + for price in prices.iter() { + let last_no_stock_balance_cache = last_no_stock_balance; + + last_no_stock_balance = std::cmp::max(last_no_stock_balance, last_with_stock_balance + price); + + last_with_stock_balance = std::cmp::max(last_with_stock_balance, sec_last_no_stock_balance - price); + + sec_last_no_stock_balance = last_no_stock_balance_cache; + } + last_no_stock_balance + } + + pub fn max_profit1(prices: Vec) -> i32 { + // max_profits[i] when holding the stock at i-th day + let mut profits_hold = vec![0;prices.len()]; + // max_profits[i] when not holding the stock at i-th day and not selling at (i-1) day. + let mut profits_empty = vec![0;prices.len()]; + // max_profits[i] when selling at i-th day. + let mut profits_cool = vec![0;prices.len()]; + + profits_hold[0] = -prices[0]; + profits_empty[0] = 0; + profits_cool[0] = -10000; // this state is invalid at 0, set it min to nullify this effect later. + + // Refer to the class diagram in https://leetcode.com/problems/best-time-to-buy-and-sell-stock-with-cooldown/discuss/75928/Share-my-DP-solution-(By-State-Machine-Thinking). + for i in 1..prices.len() { + profits_hold[i] = std::cmp::max(profits_hold[i-1], profits_empty[i-1]-prices[i]); + profits_empty[i] = std::cmp::max(profits_empty[i-1], profits_cool[i-1]); + profits_cool[i] = profits_hold[i-1] + prices[i]; + } + + std::cmp::max(*profits_empty.last().unwrap(), *profits_cool.last().unwrap()) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_309() { + assert_eq!(Solution::max_profit(vec![1, 2, 3, 0, 2]), 3); + assert_eq!(Solution::max_profit(vec![4, 2, 7, 1, 11]), 10); + } +} diff --git a/src/problem/p0310_minimum_height_trees.rs b/src/problem/p0310_minimum_height_trees.rs new file mode 100644 index 00000000..29e80b91 --- /dev/null +++ b/src/problem/p0310_minimum_height_trees.rs @@ -0,0 +1,100 @@ +/** + * [310] Minimum Height Trees + * + * A tree is an undirected graph in which any two vertices are connected by exactly one path. In other words, any connected graph without simple cycles is a tree. + * Given a tree of n nodes labelled from 0 to n - 1, and an array of n - 1 edges where edges[i] = [ai, bi] indicates that there is an undirected edge between the two nodes ai and bi in the tree, you can choose any node of the tree as the root. When you select a node x as the root, the result tree has height h. Among all possible rooted trees, those with minimum height (i.e. min(h)) are called minimum height trees (MHTs). + * Return a list of all MHTs' root labels. You can return the answer in any order. + * The height of a rooted tree is the number of edges on the longest downward path between the root and a leaf. + * + * Example 1: + * + * Input: n = 4, edges = [[1,0],[1,2],[1,3]] + * Output: [1] + * Explanation: As shown, the height of the tree is 1 when the root is the node with label 1 which is the only MHT. + * + * Example 2: + * + * Input: n = 6, edges = [[3,0],[3,1],[3,2],[3,4],[5,4]] + * Output: [3,4] + * + * Example 3: + * + * Input: n = 1, edges = [] + * Output: [0] + * + * Example 4: + * + * Input: n = 2, edges = [[0,1]] + * Output: [0,1] + * + * + * Constraints: + * + * 1 <= n <= 2 * 10^4 + * edges.length == n - 1 + * 0 <= ai, bi < n + * ai != bi + * All the pairs (ai, bi) are distinct. + * The given input is guaranteed to be a tree and there will be no repeated edges. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/minimum-height-trees/ +// discuss: https://leetcode.com/problems/minimum-height-trees/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +use std::collections::HashSet; + +impl Solution { + pub fn find_min_height_trees( n: i32, edges: Vec>) -> Vec { + if n == 1 {return vec![0];} + let mut n : usize = n as usize; + let mut adj : HashMap> = HashMap::new(); + + for edge in edges.iter() { + let n1 : i32 = edge[0]; + let n2 : i32 = edge[1]; + adj.entry(n1).or_insert(HashSet::new()).insert(n2); + adj.entry(n2).or_insert(HashSet::new()).insert(n1); + } + let mut leaves : HashSet = adj.iter().filter(|&(key, val)|{val.len() == 1}).map(|(&key, _)|{key}).collect(); + + while n > 2 { + n -= leaves.len(); + let mut next_leaves : HashSet = HashSet::new(); + for &leaf in leaves.iter() { + let parent : i32 = *adj[&leaf].iter().next().unwrap(); + adj.get_mut(&parent).unwrap().remove(&leaf); + if adj[&parent].len() == 1 {next_leaves.insert(parent);} + } + leaves = next_leaves; + } + + leaves.into_iter().collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_310() { + assert_eq!( + Solution::find_min_height_trees(4, vec![vec![1, 0], vec![1, 2], vec![1, 3]]), + vec![1] + ); + assert_eq!( + Solution::find_min_height_trees( + 6, + vec![vec![0, 3], vec![1, 3], vec![2, 3], vec![4, 3], vec![5, 4]] + ), + vec![3, 4] + ); + assert_eq!(Solution::find_min_height_trees(1, vec![]), vec![0]); + } +} diff --git a/src/problem/p0312_burst_balloons.rs b/src/problem/p0312_burst_balloons.rs new file mode 100644 index 00000000..f6bb0715 --- /dev/null +++ b/src/problem/p0312_burst_balloons.rs @@ -0,0 +1,81 @@ +/** + * [312] Burst Balloons + * + * You are given n balloons, indexed from 0 to n - 1. Each balloon is painted with a number on it represented by an array nums. You are asked to burst all the balloons. + * If you burst the i^th balloon, you will get nums[i - 1] * nums[i] * nums[i + 1] coins. If i - 1 or i + 1 goes out of bounds of the array, then treat it as if there is a balloon with a 1 painted on it. + * Return the maximum coins you can collect by bursting the balloons wisely. + * + * Example 1: + * + * Input: nums = [3,1,5,8] + * Output: 167 + * Explanation: + * nums = [3,1,5,8] --> [3,5,8] --> [3,8] --> [8] --> [] + * coins = 3*1*5 + 3*5*8 + 1*3*8 + 1*8*1 = 167 + * Example 2: + * + * Input: nums = [1,5] + * Output: 10 + * + * + * Constraints: + * + * n == nums.length + * 1 <= n <= 500 + * 0 <= nums[i] <= 100 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/burst-balloons/ +// discuss: https://leetcode.com/problems/burst-balloons/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn dp_memo(result : &mut Vec>, nums : &Vec, start : usize, end : usize) -> i32 { + if start == end {return 0} + if result[start][end] >= 0 {return result[start][end]} + let mut ans : i32 = 0; + for i in start..end { + let left_max : i32 = Self::dp_memo(result, nums, start, i); + let right_max : i32 = Self::dp_memo(result, nums, i+1, end); + let burst_ptr : i32 = nums[start] * nums[i+1] * nums[end+1]; + // if start == 3 && end == 4 { + // println!("i={}, left_max={}, right_max={}, burst_ptr={}", i, left_max, right_max, burst_ptr); + // println!("i={}, nums[start]={}, nums[i+1]={}, nums[end]={}", i, nums[start], nums[i+1], nums[end]); + // } + ans = std::cmp::max(ans, left_max + burst_ptr + right_max); + } + result[start][end] = ans; + ans + } + + pub fn max_coins(nums: Vec) -> i32 { + let n : usize = nums.len(); + let mut augmented : Vec = vec![1]; + for &num in nums.iter() { + augmented.push(num); + } + augmented.push(1); + + let mut result : Vec> = vec![vec![-1;n+1];n+1]; + Self::dp_memo(&mut result, &augmented, 0usize, n); + for r in result.iter() { + println!("{:?}", r); + } + result[0][n] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_312() { + assert_eq!(Solution::max_coins(vec![3, 1, 5, 8]), 167); + } +} diff --git a/src/problem/p0313_super_ugly_number.rs b/src/problem/p0313_super_ugly_number.rs new file mode 100644 index 00000000..8ceba63c --- /dev/null +++ b/src/problem/p0313_super_ugly_number.rs @@ -0,0 +1,69 @@ +/** + * [313] Super Ugly Number + * + * A super ugly number is a positive integer whose prime factors are in the array primes. + * Given an integer n and an array of integers primes, return the n^th super ugly number. + * The n^th super ugly number is guaranteed to fit in a 32-bit signed integer. + * + * Example 1: + * + * Input: n = 12, primes = [2,7,13,19] + * Output: 32 + * Explanation: [1,2,4,7,8,13,14,16,19,26,28,32] is the sequence of the first 12 super ugly numbers given primes = [2,7,13,19]. + * + * Example 2: + * + * Input: n = 1, primes = [2,3,5] + * Output: 1 + * Explanation: 1 has no prime factors, therefore all of its prime factors are in the array primes = [2,3,5]. + * + * + * Constraints: + * + * 1 <= n <= 10^6 + * 1 <= primes.length <= 100 + * 2 <= primes[i] <= 1000 + * primes[i] is guaranteed to be a prime number. + * All the values of primes are unique and sorted in ascending order. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/super-ugly-number/ +// discuss: https://leetcode.com/problems/super-ugly-number/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn nth_super_ugly_number(n: i32, primes: Vec) -> i32 { + let n : usize = n as usize; + let mut result : Vec = vec![!(1<<31);n]; + result[0] = 1; + + let plen : usize = primes.len(); + let mut prime_ptrs : Vec = vec![0;plen]; + for i in 1..n { + for j in 0..plen { + result[i] = std::cmp::min(result[i], result[prime_ptrs[j]] * primes[j]); + } + for j in 0..plen { + if result[i] == result[prime_ptrs[j]] * primes[j] { + prime_ptrs[j]+=1; + } + } + } + result[n-1] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_313() { + assert_eq!(Solution::nth_super_ugly_number(12, vec![2, 7, 13, 19]), 32); + } +} diff --git a/src/problem/p0315_count_of_smaller_numbers_after_self.rs b/src/problem/p0315_count_of_smaller_numbers_after_self.rs new file mode 100644 index 00000000..2bde56c9 --- /dev/null +++ b/src/problem/p0315_count_of_smaller_numbers_after_self.rs @@ -0,0 +1,90 @@ +/** + * [315] Count of Smaller Numbers After Self + * + * You are given an integer array nums and you have to return a new counts array. The counts array has the property where counts[i] is the number of smaller elements to the right of nums[i]. + * + * Example 1: + * + * Input: nums = [5,2,6,1] + * Output: [2,1,1,0] + * Explanation: + * To the right of 5 there are 2 smaller elements (2 and 1). + * To the right of 2 there is only 1 smaller element (1). + * To the right of 6 there is 1 smaller element (1). + * To the right of 1 there is 0 smaller element. + * + * Example 2: + * + * Input: nums = [-1] + * Output: [0] + * + * Example 3: + * + * Input: nums = [-1,-1] + * Output: [0,0] + * + * + * Constraints: + * + * 1 <= nums.length <= 10^5 + * -10^4 <= nums[i] <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/count-of-smaller-numbers-after-self/ +// discuss: https://leetcode.com/problems/count-of-smaller-numbers-after-self/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn merge_sort_index (nums : &Vec, right_smaller_count : &mut Vec, indices : Vec, level : usize) -> Vec { + let pad : String = (0..level).map(|_|{"...."}).collect(); + let n : usize = indices.len(); + if n == 1 {return indices} + let mid : usize = n / 2; + let left : Vec = indices.iter().take(mid).cloned().collect(); + let right : Vec = indices.iter().skip(mid).cloned().collect(); + let mut left : Vec = Self::merge_sort_index(nums, right_smaller_count, left, level + 1); + let mut right : Vec = Self::merge_sort_index(nums, right_smaller_count, right, level + 1); + + let mut sorted_inversed : Vec = vec![]; + // println!("{}left={:?}, right={:?}", pad, left, right); + while left.len() !=0 || right.len() != 0 { + let is_left_greater : bool = (right.len() == 0 || left.len() !=0 && nums[*left.last().unwrap()] > nums[*right.last().unwrap()]); + + if is_left_greater { + let left_greatest_index : usize = left.pop().unwrap(); + sorted_inversed.push(left_greatest_index); + // Shift this num from the left to right, count the surpassed right nums. + right_smaller_count[left_greatest_index] += right.len() as i32; + } else { + let right_greatest_index : usize = right.pop().unwrap(); + sorted_inversed.push(right_greatest_index); + } + } + let sorted_index : Vec = sorted_inversed.into_iter().rev().collect(); + + // println!("{}sorted={:?}, right_smaller={:?}", pad, sorted_index, right_smaller_count); + sorted_index + } + + pub fn count_smaller(nums: Vec) -> Vec { + let mut right_smaller_count : Vec = vec![0i32; nums.len()]; + let indices : Vec = (0..(nums.len())).collect(); + Self::merge_sort_index(&nums, &mut right_smaller_count, indices, 0); + right_smaller_count + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_315() { + assert_eq!(Solution::count_smaller(vec![5,2,6,1]), vec![2,1,1,0]); + } +} diff --git a/src/problem/p0316_remove_duplicate_letters.rs b/src/problem/p0316_remove_duplicate_letters.rs new file mode 100644 index 00000000..29be45d6 --- /dev/null +++ b/src/problem/p0316_remove_duplicate_letters.rs @@ -0,0 +1,78 @@ +/** + * [316] Remove Duplicate Letters + * + * Given a string s, remove duplicate letters so that every letter appears once and only once. You must make sure your result is the smallest in lexicographical order among all possible results. + * + * Example 1: + * + * Input: s = "bcabc" + * Output: "abc" + * + * Example 2: + * + * Input: s = "cbacdcbc" + * Output: "acdb" + * + * + * Constraints: + * + * 1 <= s.length <= 10^4 + * s consists of lowercase English letters. + * + * + * Note: This question is the same as 1081: https://leetcode.com/problems/smallest-subsequence-of-distinct-characters/ + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/remove-duplicate-letters/ +// discuss: https://leetcode.com/problems/remove-duplicate-letters/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +use std::collections::HashSet; +impl Solution { + pub fn remove_duplicate_letters(s: String) -> String { + let s : Vec = s.chars().collect(); + let mut char_counts : HashMap = HashMap::new(); + for &c in s.iter() { + *char_counts.entry(c).or_insert(0)+=1; + } + + let mut stack : Vec = vec![]; + let mut in_stack : HashSet = HashSet::new(); + for &c in s.iter() { + *char_counts.get_mut(&c).unwrap()-=1; + if in_stack.contains(&c) {continue;} + + while let Some(&last_char) = stack.last() { + if (last_char as u8) > (c as u8) && char_counts[&last_char] > 0 { + stack.pop(); + in_stack.remove(&last_char); + } else { + break; + } + } + + stack.push(c); + in_stack.insert(c); + } + stack.into_iter().collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_316() { + assert_eq!(Solution::remove_duplicate_letters("bcabc".to_owned()), "abc".to_owned()); + + assert_eq!(Solution::remove_duplicate_letters("cbacdcbc".to_owned()), "acdb".to_owned()); + + assert_eq!(Solution::remove_duplicate_letters("bbcaac".to_owned()), "bac".to_owned()); + } +} diff --git a/src/problem/p0318_maximum_product_of_word_lengths.rs b/src/problem/p0318_maximum_product_of_word_lengths.rs new file mode 100644 index 00000000..beb7dabd --- /dev/null +++ b/src/problem/p0318_maximum_product_of_word_lengths.rs @@ -0,0 +1,67 @@ +/** + * [318] Maximum Product of Word Lengths + * + * Given a string array words, return the maximum value of length(word[i]) * length(word[j]) where the two words do not share common letters. If no such two words exist, return 0. + * + * Example 1: + * + * Input: words = ["abcw","baz","foo","bar","xtfn","abcdef"] + * Output: 16 + * Explanation: The two words can be "abcw", "xtfn". + * + * Example 2: + * + * Input: words = ["a","ab","abc","d","cd","bcd","abcd"] + * Output: 4 + * Explanation: The two words can be "ab", "cd". + * + * Example 3: + * + * Input: words = ["a","aa","aaa","aaaa"] + * Output: 0 + * Explanation: No such pair of words. + * + * + * Constraints: + * + * 2 <= words.length <= 1000 + * 1 <= words[i].length <= 1000 + * words[i] consists only of lowercase English letters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/maximum-product-of-word-lengths/ +// discuss: https://leetcode.com/problems/maximum-product-of-word-lengths/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + + +impl Solution { pub fn max_product(words: Vec) -> i32 { + let mut word_int = vec![0; words.len()]; + let mut result = 0; + for (i, word) in words.iter().enumerate() { + // word[i] encodes words[i] in the below format: + // if char x exists, the x-'a' digit is set. + word_int[i] = + word.chars().fold(0, |acc, c|{acc|(1 << (c as usize - 'a' as usize))}); + for j in 0..i { + if word_int[i] & word_int[j] == 0 { + result = std::cmp::max(result, words[i].len() * words[j].len()); + } + } + } + result as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_318() { + } +} diff --git a/src/problem/p0319_bulb_switcher.rs b/src/problem/p0319_bulb_switcher.rs new file mode 100644 index 00000000..019afe7c --- /dev/null +++ b/src/problem/p0319_bulb_switcher.rs @@ -0,0 +1,56 @@ +/** + * [319] Bulb Switcher + * + * There are n bulbs that are initially off. You first turn on all the bulbs, then you turn off every second bulb. + * On the third round, you toggle every third bulb (turning on if it's off or turning off if it's on). For the i^th round, you toggle every i bulb. For the n^th round, you only toggle the last bulb. + * Return the number of bulbs that are on after n rounds. + * + * Example 1: + * + * Input: n = 3 + * Output: 1 + * Explanation: At first, the three bulbs are [off, off, off]. + * After the first round, the three bulbs are [on, on, on]. + * After the second round, the three bulbs are [on, off, on]. + * After the third round, the three bulbs are [on, off, off]. + * So you should return 1 because there is only one bulb is on. + * Example 2: + * + * Input: n = 0 + * Output: 0 + * + * Example 3: + * + * Input: n = 1 + * Output: 1 + * + * + * Constraints: + * + * 0 <= n <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/bulb-switcher/ +// discuss: https://leetcode.com/problems/bulb-switcher/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn bulb_switch(n: i32) -> i32 { + // Smart trick as explained in https://leetcode.com/problems/bulb-switcher/discuss/77104/Math-solution.. + (n as f64).sqrt() as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_319() { + } +} diff --git a/src/problem/p0321_create_maximum_number.rs b/src/problem/p0321_create_maximum_number.rs new file mode 100644 index 00000000..7b0bf24c --- /dev/null +++ b/src/problem/p0321_create_maximum_number.rs @@ -0,0 +1,118 @@ +/** + * [321] Create Maximum Number + * + * You are given two integer arrays nums1 and nums2 of lengths m and n respectively. nums1 and nums2 represent the digits of two numbers. You are also given an integer k. + * Create the maximum number of length k <= m + n from digits of the two numbers. The relative order of the digits from the same array must be preserved. + * Return an array of the k digits representing the answer. + * + * Example 1: + * + * Input: nums1 = [3,4,6,5], nums2 = [9,1,2,5,8,3], k = 5 + * Output: [9,8,6,5,3] + * + * Example 2: + * + * Input: nums1 = [6,7], nums2 = [6,0,4], k = 5 + * Output: [6,7,6,0,4] + * + * Example 3: + * + * Input: nums1 = [3,9], nums2 = [8,9], k = 3 + * Output: [9,8,9] + * + * + * Constraints: + * + * m == nums1.length + * n == nums2.length + * 1 <= m, n <= 500 + * 0 <= nums1[i], nums2[i] <= 9 + * 1 <= k <= m + n + * + * + * Follow up: Try to optimize your time and space complexity. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/create-maximum-number/ +// discuss: https://leetcode.com/problems/create-maximum-number/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn max_num(nums : &Vec, k : usize) -> Vec { + let mut result : Vec = vec![]; + let n : usize = nums.len(); + for (i, &num) in nums.iter().enumerate() { + while result.len() != 0 && result.len() + (n-i) > k { + if *result.last().unwrap() < num { + result.pop(); + } else { + break; + } + } + + if result.len() < k { + result.push(num); + } + } + // println!("nums={:?}, k={}, result={:?}", nums, k, result); + result + } + + pub fn is_nums1_greater(nums1 : &Vec, nums1_start : usize, nums2 : &Vec, nums2_start : usize) -> bool { + let mut i = nums1_start; + let mut j = nums2_start; + while i < nums1.len() && j < nums2.len() && nums1[i] == nums2[j] { + i += 1; + j += 1; + } + j == nums2.len() || i < nums1.len() && nums1[i] > nums2[j] + } + + pub fn merge(nums1 : &Vec, nums2 : &Vec) -> Vec { + let mut result : Vec = vec![]; + let mut i : usize = 0; + let mut j : usize = 0; + while result.len() != nums1.len() + nums2.len() { + if Self::is_nums1_greater(nums1, i, nums2, j) { + result.push(nums1[i]); + i+=1; + } else { + result.push(nums2[j]); + j+=1; + } + } + result + } + + pub fn max_number(nums1: Vec, nums2: Vec, k: i32) -> Vec { + let k : usize = k as usize; + let mut ans = vec![]; + let min_from_num1 : usize = if k > nums2.len() {k - nums2.len()} else {0}; + let max_from_num1 : usize = if k > nums1.len() {nums1.len()} else {k}; + + for i in (min_from_num1..=max_from_num1) { + let candidate = Self::merge(&Self::max_num(&nums1, i), &Self::max_num(&nums2, k-i)); + if Self::is_nums1_greater(&candidate, 0, &ans, 0) { + ans = candidate; + } + } + ans + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_321() { + assert_eq!(Solution::max_number(vec![3,4,6,5], vec![9,1,2,5,8,3], 5), vec![9,8,6,5,3]); + assert_eq!(Solution::max_number(vec![6,7], vec![6,0,4], 5), vec![6,7,6,0,4]); + assert_eq!(Solution::max_number(vec![3,9], vec![8,9], 3), vec![9,8,9]); + } +} diff --git a/src/problem/p0322_coin_change.rs b/src/problem/p0322_coin_change.rs new file mode 100644 index 00000000..2f78f7d8 --- /dev/null +++ b/src/problem/p0322_coin_change.rs @@ -0,0 +1,116 @@ +/** + * [322] Coin Change + * + * You are given an integer array coins representing coins of different denominations and an integer amount representing a total amount of money. + * Return the fewest number of coins that you need to make up that amount. If that amount of money cannot be made up by any combination of the coins, return -1. + * You may assume that you have an infinite number of each kind of coin. + * + * Example 1: + * + * Input: coins = [1,2,5], amount = 11 + * Output: 3 + * Explanation: 11 = 5 + 5 + 1 + * + * Example 2: + * + * Input: coins = [2], amount = 3 + * Output: -1 + * + * Example 3: + * + * Input: coins = [1], amount = 0 + * Output: 0 + * + * Example 4: + * + * Input: coins = [1], amount = 1 + * Output: 1 + * + * Example 5: + * + * Input: coins = [1], amount = 2 + * Output: 2 + * + * + * Constraints: + * + * 1 <= coins.length <= 12 + * 1 <= coins[i] <= 2^31 - 1 + * 0 <= amount <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/coin-change/ +// discuss: https://leetcode.com/problems/coin-change/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn coin_change(mut coins: Vec, amount: i32) -> i32 { + let amount : usize = amount as usize; + let mut result : Vec> = vec![vec![-1;amount+1];coins.len()+1]; + // result[i][j] represent the ways to make amount i with the first j coins. + + result[0][0] = 0; + for i in 1..=coins.len() { + result[i][0] = 0; + for j in 1..=amount { + let this_coin : usize = coins[i-1] as usize; + + //make up only using the first i-1 coints. + if result[i-1][j] != -1 { + result[i][j] = result[i-1][j]; + } + + if this_coin <= j && result[i][j-this_coin] != -1 { + if result[i][j] != -1 { + result[i][j] = std::cmp::min(result[i][j], 1 + result[i][j-this_coin]); + } else { + result[i][j] = 1 + result[i][j-this_coin]; + } + } + } + } + // println!("result={:?}", result); + result[coins.len()][amount] + } + + // pub fn coin_change_old(mut coins: Vec, amount: i32) -> i32 { + // let k_large = 100000; + // coins.sort(); + // let amount = amount as usize; + // let mut change_ways = vec![k_large; amount+1]; + // change_ways[0] = 0; + // for i in 1..=amount { + // let i = i as usize; + // for &coin_num in &coins { + // let coin_num = coin_num as usize; + // // if i is not changeable from i-1, i-2 and i-5, + // // change_ways[i] will still be greater than k_large due to the min op. + // if coin_num <= i { + // change_ways[i] = std::cmp::min(change_ways[i], change_ways[i-coin_num]+1); + // } + // // println!("{:?}", change_ways); + // } + // } + // if change_ways[amount] >= k_large { + // -1 + // } else { + // change_ways[amount] + // } + // } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_322() { + assert_eq!(Solution::coin_change(vec![2], 3), -1); + assert_eq!(Solution::coin_change(vec![2, 5, 10, 1], 27), 4); + } +} diff --git a/src/problem/p0324_wiggle_sort_ii.rs b/src/problem/p0324_wiggle_sort_ii.rs new file mode 100644 index 00000000..40b18355 --- /dev/null +++ b/src/problem/p0324_wiggle_sort_ii.rs @@ -0,0 +1,94 @@ +/** + * [324] Wiggle Sort II + * + * Given an integer array nums, reorder it such that nums[0] < nums[1] > nums[2] < nums[3].... + * You may assume the input array always has a valid answer. + * + * Example 1: + * + * Input: nums = [1,5,1,1,6,4] + * Output: [1,6,1,5,1,4] + * Explanation: [1,4,1,5,1,6] is also accepted. + * + * Example 2: + * + * Input: nums = [1,3,2,2,3,1] + * Output: [2,3,1,3,1,2] + * + * + * Constraints: + * + * 1 <= nums.length <= 5 * 10^4 + * 0 <= nums[i] <= 5000 + * It is guaranteed that there will be an answer for the given input nums. + * + * + * Follow Up: Can you do it in O(n) time and/or in-place with O(1) extra space? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/wiggle-sort-ii/ +// discuss: https://leetcode.com/problems/wiggle-sort-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + + fn find_kth(nums : &Vec, k: usize) -> i32 { + let num1 = nums[0]; + let mut lt_nums = vec![]; + let mut ge_nums = vec![]; + for i in 1..nums.len() { + if nums[i] < num1 { + lt_nums.push(nums[i]); + } else { + ge_nums.push(nums[i]); + } + } + + if lt_nums.len() == k { + num1 + } else if lt_nums.len() < k { + Self::find_kth(&ge_nums, k - lt_nums.len() - 1) + } else { + Self::find_kth(<_nums, k) + } + } + pub fn wiggle_sort(nums: &mut Vec) { + if nums.len() < 2 {return} + let n = nums.len(); + let median = Self::find_kth(nums, (nums.len() - 1)/2); + // println!("median = {}", median); + let idx_map : Vec = (0..nums.len()).map(|x| {(1+2*x) % (n | 1)}).collect(); + // println!("idx_map={:?}", idx_map); + let mut left = 0; + let mut i = 0; + let mut right = n - 1; + while i <= right { + if nums[idx_map[i]] > median { + nums.swap(idx_map[i], idx_map[left]); + i+=1; + left+=1; + } else if nums[idx_map[i]] < median { + nums.swap(idx_map[i], idx_map[right]); + right-=1; + } else { + i+=1; + } + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_324() { + let mut r = vec![1,5,1,1,6,4]; + Solution::wiggle_sort(&mut r); + assert_eq!(r, vec![1,6,1,5,1,4]); + } +} diff --git a/src/problem/p0327_count_of_range_sum.rs b/src/problem/p0327_count_of_range_sum.rs new file mode 100644 index 00000000..e5ad2001 --- /dev/null +++ b/src/problem/p0327_count_of_range_sum.rs @@ -0,0 +1,156 @@ +/** + * [327] Count of Range Sum + * + * Given an integer array nums and two integers lower and upper, return the number of range sums that lie in [lower, upper] inclusive. + * Range sum S(i, j) is defined as the sum of the elements in nums between indices i and j inclusive, where i <= j. + * + * Example 1: + * + * Input: nums = [-2,5,-1], lower = -2, upper = 2 + * Output: 3 + * Explanation: The three ranges are: [0,0], [2,2], and [0,2] and their respective sums are: -2, -1, 2. + * + * Example 2: + * + * Input: nums = [0], lower = 0, upper = 0 + * Output: 1 + * + * + * Constraints: + * + * 1 <= nums.length <= 10^4 + * -2^31 <= nums[i] <= 2^31 - 1 + * -10^5 <= lower <= upper <= 10^5 + * The answer is guaranteed to fit in a 32-bit integer. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/count-of-range-sum/ +// discuss: https://leetcode.com/problems/count-of-range-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn last_lt_idx(nums : &Vec, base : i64, sorted_idx : &Vec, target : i64) -> i32 { + let mut lower : i32 = 0; + let mut higher : i32 = sorted_idx.len() as i32 - 1; + while lower <= higher { + let valid = |i : usize|{nums[sorted_idx[i]] - base < target}; + let mid = (lower + higher) / 2; + if valid(mid as usize) { + if mid as usize == sorted_idx.len() - 1 || !valid(mid as usize + 1) { + return mid; + } else { + lower = mid + 1; + } + } else { + higher = mid - 1; + } + } + -1 as i32 + } + + pub fn last_le_idx(nums : &Vec, base : i64, sorted_idx : &Vec, target : i64) -> i32 { + let mut lower : i32 = 0; + let mut higher : i32 = sorted_idx.len() as i32 - 1; + let valid = |i : usize|{nums[sorted_idx[i]] - base <= target}; + while lower <= higher { + // println!("lower={}, higher={}, sorted_idx={:?}", lower, higher, sorted_idx); + let mid = (lower + higher) / 2; + if valid(mid as usize) { + if mid as usize == sorted_idx.len() - 1 || !valid(mid as usize + 1) { + return mid; + } else { + lower = mid + 1; + } + } else { + higher = mid - 1; + } + } + -1 as i32 + } + + + pub fn count_in_mergesort_index(counts : &mut Vec, nums : &Vec, idx_to_sort : &Vec, lower : i64, higher : i64) -> Vec { + let n : usize = idx_to_sort.len(); + if n > 1 { + let mut idx_to_sort1 : Vec = idx_to_sort.clone(); + let idx_to_sort2 : Vec = idx_to_sort1.split_off(n/2); + let left_idx_sorted : Vec = Self::count_in_mergesort_index(counts, nums, &idx_to_sort1, lower, higher); + let right_idx_sorted : Vec = Self::count_in_mergesort_index(counts, nums, &idx_to_sort2, lower, higher); + + let mut left_i : usize = 0; + let left_count : usize = left_idx_sorted.len(); + + let mut right_i : usize = 0; + let right_count : usize = right_idx_sorted.len(); + let mut merged_idx : Vec = vec![]; + while left_i != left_count || right_i != right_count { + if right_i == right_count || (left_i != left_count && nums[left_idx_sorted[left_i]] < nums[right_idx_sorted[right_i]]) { + + let mut right_lt_lower_count : i32 = Self::last_lt_idx(&nums, nums[left_idx_sorted[left_i]], &right_idx_sorted, lower) + 1; + // let mut right_lt_lower_count : i32 = 0; + // for &right_idx in right_idx_sorted.iter() { + // if nums[right_idx] - nums[left_idx_sorted[left_i]] < lower { + // right_lt_lower_count+=1; + // } else { + // break; + // } + // } + + let mut right_le_higher_count : i32 = Self::last_le_idx(&nums, nums[left_idx_sorted[left_i]], &right_idx_sorted, higher) + 1; + // let mut right_le_higher_count : i32 = 0; + // for &right_idx in right_idx_sorted.iter() { + // if nums[right_idx] - nums[left_idx_sorted[left_i]] <= higher { + // right_le_higher_count+=1; + // } else { + // break; + // } + // } + counts[left_idx_sorted[left_i]] += right_le_higher_count - right_lt_lower_count; + + merged_idx.push(left_idx_sorted[left_i]); + left_i+=1; + } else { + merged_idx.push(right_idx_sorted[right_i]); + right_i+=1; + } + } + + return merged_idx; + + + } else { + return idx_to_sort.clone(); + } + } + + pub fn count_range_sum(nums: Vec, lower: i32, upper: i32) -> i32 { + let mut prefix_sum : Vec = vec![0]; + let mut cur_sum : i64 = 0; + for &num in nums.iter() { + cur_sum += num as i64; + prefix_sum.push(cur_sum); + } + let n : usize = nums.len(); + let mut right_inrange_count : Vec = vec![0; n+1]; + let init_idx : Vec = (0..=n).collect(); + Self::count_in_mergesort_index(&mut right_inrange_count, &prefix_sum, &init_idx, lower as i64, upper as i64); + // println!("right_inrange_count={:?}", right_inrange_count); + right_inrange_count.iter().sum() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_327() { + assert_eq!(Solution::count_range_sum(vec![-2,5,-1], -2,2), 3); + assert_eq!(Solution::count_range_sum(vec![0], 0,0), 1); + } +} diff --git a/src/problem/p0328_odd_even_linked_list.rs b/src/problem/p0328_odd_even_linked_list.rs new file mode 100644 index 00000000..8cece98a --- /dev/null +++ b/src/problem/p0328_odd_even_linked_list.rs @@ -0,0 +1,92 @@ +/** + * [328] Odd Even Linked List + * + * Given the head of a singly linked list, group all the nodes with odd indices together followed by the nodes with even indices, and return the reordered list. + * The first node is considered odd, and the second node is even, and so on. + * Note that the relative order inside both the even and odd groups should remain as it was in the input. + * + * Example 1: + * + * Input: head = [1,2,3,4,5] + * Output: [1,3,5,2,4] + * + * Example 2: + * + * Input: head = [2,1,3,5,6,4,7] + * Output: [2,3,6,7,1,5,4] + * + * + * Constraints: + * + * The number of nodes in the linked list is in the range [0, 10^4]. + * -10^6 <= Node.val <= 10^6 + * + * + * Follow up: Could you solve it in O(1) space complexity and O(nodes) time complexity? + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/odd-even-linked-list/ +// discuss: https://leetcode.com/problems/odd-even-linked-list/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn separate(head: Option>) -> (Option>, Option>) { + if let None = head { + return (None, None); + } else if let None = head.as_ref().unwrap().next { + return (head, None); + } else { + // node -> node1 -> node2 (node2 can be NONE. ) + let mut node:Box = head.unwrap(); + let mut node1:Box = node.next.unwrap(); + let (odd, even) = Self::separate(node1.next); + node.next = odd; + node1.next = even; + return (Some(node), Some(node1)); + } + } + + pub fn odd_even_list(head: Option>) -> Option> { + let (mut odd, mut even) = Self::separate(head); + if let None = odd { + return None; + } + let mut odd_node = &mut odd; + while odd_node.as_ref().unwrap().next.is_some() { + odd_node = &mut odd_node.as_mut().unwrap().next; + } + odd_node.as_mut().unwrap().next = even; + return odd; + // Some(Box::new(ListNode::new(0))) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_328() { + } +} diff --git a/src/problem/p0329_longest_increasing_path_in_a_matrix.rs b/src/problem/p0329_longest_increasing_path_in_a_matrix.rs new file mode 100644 index 00000000..9af732a2 --- /dev/null +++ b/src/problem/p0329_longest_increasing_path_in_a_matrix.rs @@ -0,0 +1,94 @@ +/** + * [329] Longest Increasing Path in a Matrix + * + * Given an m x n integers matrix, return the length of the longest increasing path in matrix. + * From each cell, you can either move in four directions: left, right, up, or down. You may not move diagonally or move outside the boundary (i.e., wrap-around is not allowed). + * + * Example 1: + * + * Input: matrix = [[9,9,4],[6,6,8],[2,1,1]] + * Output: 4 + * Explanation: The longest increasing path is [1, 2, 6, 9]. + * + * Example 2: + * + * Input: matrix = [[3,4,5],[3,2,6],[2,2,1]] + * Output: 4 + * Explanation: The longest increasing path is [3, 4, 5, 6]. Moving diagonally is not allowed. + * + * Example 3: + * + * Input: matrix = [[1]] + * Output: 1 + * + * + * Constraints: + * + * m == matrix.length + * n == matrix[i].length + * 1 <= m, n <= 200 + * 0 <= matrix[i][j] <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/longest-increasing-path-in-a-matrix/ +// discuss: https://leetcode.com/problems/longest-increasing-path-in-a-matrix/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn compute(all_longest : &mut Vec>, matrix : &Vec>, i : usize, j : usize) -> i32 { + if all_longest[i][j] != -1 { + return all_longest[i][j]; + } + + let row_count : usize = all_longest.len(); + let col_count : usize = all_longest[0].len(); + let mut nearby_max_longest : i32 = 0; + + if 0 < i && matrix[i-1][j] < matrix[i][j] { + nearby_max_longest = std::cmp::max(nearby_max_longest, Self::compute(all_longest, matrix, i - 1, j)); + } + + if i < row_count - 1 && matrix[i+1][j] < matrix[i][j] { + nearby_max_longest = std::cmp::max(nearby_max_longest, Self::compute(all_longest, matrix, i + 1, j)); + } + + if 0 < j && matrix[i][j-1] < matrix[i][j] { + nearby_max_longest = std::cmp::max(nearby_max_longest, Self::compute(all_longest, matrix, i, j-1)); + } + + if j < col_count - 1 && matrix[i][j+1] < matrix[i][j] { + nearby_max_longest = std::cmp::max(nearby_max_longest, Self::compute(all_longest, matrix, i, j+1)); + } + all_longest[i][j] = nearby_max_longest + 1; + return all_longest[i][j]; + } + + pub fn longest_increasing_path(matrix: Vec>) -> i32 { + let row_count : usize = matrix.len(); + let col_count : usize = matrix[0].len(); + let mut all_longest : Vec> = vec![vec![-1;col_count];row_count]; + let mut longest : i32 = 0; + for i in 0..row_count { + for j in 0..col_count { + Self::compute(&mut all_longest, &matrix, i, j); + longest = std::cmp::max(longest, all_longest[i][j]); + } + } + longest + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_329() { + assert_eq!(Solution::longest_increasing_path( vec![vec![9,9,4],vec![6,6,8],vec![2,1,1]]), 4); + } +} diff --git a/src/problem/p0330_patching_array.rs b/src/problem/p0330_patching_array.rs new file mode 100644 index 00000000..e31cb326 --- /dev/null +++ b/src/problem/p0330_patching_array.rs @@ -0,0 +1,74 @@ +/** + * [330] Patching Array + * + * Given a sorted integer array nums and an integer n, add/patch elements to the array such that any number in the range [1, n] inclusive can be formed by the sum of some elements in the array. + * Return the minimum number of patches required. + * + * Example 1: + * + * Input: nums = [1,3], n = 6 + * Output: 1 + * Explanation: + * Combinations of nums are [1], [3], [1,3], which form possible sums of: 1, 3, 4. + * Now if we add/patch 2 to nums, the combinations are: [1], [2], [3], [1,3], [2,3], [1,2,3]. + * Possible sums are 1, 2, 3, 4, 5, 6, which now covers the range [1, 6]. + * So we only need 1 patch. + * + * Example 2: + * + * Input: nums = [1,5,10], n = 20 + * Output: 2 + * Explanation: The two patches can be [2, 4]. + * + * Example 3: + * + * Input: nums = [1,2,2], n = 5 + * Output: 0 + * + * + * Constraints: + * + * 1 <= nums.length <= 1000 + * 1 <= nums[i] <= 10^4 + * nums is sorted in ascending order. + * 1 <= n <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/patching-array/ +// discuss: https://leetcode.com/problems/patching-array/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn min_patches(nums: Vec, n: i32) -> i32 { + let mut miss_count : i32 = 0; + let mut next_miss : i64 = 1; + let n = n as i64; + let mut i : usize = 0; + while next_miss <= n { + if i < nums.len() && nums[i] as i64 <= next_miss { + next_miss += nums[i] as i64; + i+=1; + } else { + miss_count += 1; + next_miss *= 2; + } + } + miss_count + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_330() { + assert_eq!(Solution::min_patches(vec![1,3], 6), 1); + assert_eq!(Solution::min_patches(vec![1,5,10], 20), 2); + } +} diff --git a/src/problem/p0331_verify_preorder_serialization_of_a_binary_tree.rs b/src/problem/p0331_verify_preorder_serialization_of_a_binary_tree.rs new file mode 100644 index 00000000..51b3c102 --- /dev/null +++ b/src/problem/p0331_verify_preorder_serialization_of_a_binary_tree.rs @@ -0,0 +1,104 @@ +/** + * [331] Verify Preorder Serialization of a Binary Tree + * + * One way to serialize a binary tree is to use preorder traversal. When we encounter a non-null node, we record the node's value. If it is a null node, we record using a sentinel value such as '#'. + * + * For example, the above binary tree can be serialized to the string "9,3,4,#,#,1,#,#,2,#,6,#,#", where '#' represents a null node. + * Given a string of comma-separated values preorder, return true if it is a correct preorder traversal serialization of a binary tree. + * It is guaranteed that each comma-separated value in the string must be either an integer or a character '#' representing null pointer. + * You may assume that the input format is always valid. + * + * For example, it could never contain two consecutive commas, such as "1,,3". + * + * Note: You are not allowed to reconstruct the tree. + * + * Example 1: + * Input: preorder = "9,3,4,#,#,1,#,#,2,#,6,#,#" + * Output: true + * Example 2: + * Input: preorder = "1,#" + * Output: false + * Example 3: + * Input: preorder = "9,#,#,1" + * Output: false + * + * Constraints: + * + * 1 <= preorder.length <= 10^4 + * preoder consist of integers in the range [0, 100] and '#' separated by commas ','. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/verify-preorder-serialization-of-a-binary-tree/ +// discuss: https://leetcode.com/problems/verify-preorder-serialization-of-a-binary-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +const LEFT : i32 = 0; +const RIGHT : i32 = 1; + +impl Solution { + pub fn is_valid_serialization(preorder: String) -> bool { + let mut preorder = preorder; + preorder.push(','); + + let mut prev_str : String = String::from(""); + let mut stack : Vec<(i32, i32)> = vec![]; + let len : usize = preorder.len(); + + for (i, c) in preorder.chars().enumerate() { + if c == ',' { + if let Ok(num) = prev_str.parse::() { + stack.push((num, LEFT)); + } else { + // println!("=============================="); + // println!("i={}, c={}, prev_str={}", i, c, prev_str); + // println!("Before: {:?}", stack); + while let Some(&(last_num, state)) = stack.last() { + if state == RIGHT { + stack.pop(); + } else { + break; + } + } + + if let Some((last_num, state)) = stack.pop() { + if state == LEFT { + stack.push((last_num, RIGHT)); + } + // println!("Post: {:?}", stack); + // println!("=============================") + } else { + if i == len - 1 { + return true; + } else { + return false; + } + } + + } + + + prev_str = "".to_owned(); + } else { + // digits or # + prev_str.push(c); + } + } + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_331() { + assert!(Solution::is_valid_serialization("9,3,4,#,#,1,#,#,2,#,6,#,#".to_owned())); + assert!(!Solution::is_valid_serialization("1,#".to_owned())); + assert!(!Solution::is_valid_serialization("9,#,#,1".to_owned())); + } +} diff --git a/src/problem/p0332_reconstruct_itinerary.rs b/src/problem/p0332_reconstruct_itinerary.rs new file mode 100644 index 00000000..1c760e0d --- /dev/null +++ b/src/problem/p0332_reconstruct_itinerary.rs @@ -0,0 +1,98 @@ +/** + * [332] Reconstruct Itinerary + * + * You are given a list of airline tickets where tickets[i] = [fromi, toi] represent the departure and the arrival airports of one flight. Reconstruct the itinerary in order and return it. + * All of the tickets belong to a man who departs from "JFK", thus, the itinerary must begin with "JFK". If there are multiple valid itineraries, you should return the itinerary that has the smallest lexical order when read as a single string. + * + * For example, the itinerary ["JFK", "LGA"] has a smaller lexical order than ["JFK", "LGB"]. + * + * You may assume all tickets form at least one valid itinerary. You must use all the tickets once and only once. + * + * Example 1: + * + * Input: tickets = [["MUC","LHR"],["JFK","MUC"],["SFO","SJC"],["LHR","SFO"]] + * Output: ["JFK","MUC","LHR","SFO","SJC"] + * + * Example 2: + * + * Input: tickets = [["JFK","SFO"],["JFK","ATL"],["SFO","ATL"],["ATL","JFK"],["ATL","SFO"]] + * Output: ["JFK","ATL","JFK","SFO","ATL","SFO"] + * Explanation: Another possible reconstruction is ["JFK","SFO","ATL","JFK","ATL","SFO"] but it is larger in lexical order. + * + * + * Constraints: + * + * 1 <= tickets.length <= 300 + * tickets[i].length == 2 + * fromi.length == 3 + * toi.length == 3 + * fromi and toi consist of uppercase English letters. + * fromi != toi + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/reconstruct-itinerary/ +// discuss: https://leetcode.com/problems/reconstruct-itinerary/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn helper(tickets : &Vec>, itinerary : &mut HashMap>, route : &mut Vec) -> bool { + let cur_pos : String = route.last().unwrap().clone(); + if route.len() == tickets.len() + 1 { + return true; + } + if let Some(next_destinations) = itinerary.get(&cur_pos) { + let mut destinations : Vec = next_destinations.iter().filter(|(_, &count)|{count > 0}).map(|(dest, _)|{dest.clone()}).collect(); + destinations.sort(); + + // println!("cur_pos={}, destinations={:?}", cur_pos, destinations); + + for dest in destinations.iter() { + *itinerary.get_mut(&cur_pos).unwrap().get_mut(dest).unwrap() -=1; + route.push(dest.clone()); + + if Self::helper(tickets, itinerary, route) { + return true; + } + + route.pop(); + *itinerary.get_mut(&cur_pos).unwrap().get_mut(dest).unwrap() +=1; + } + + } + false + } + + pub fn find_itinerary(tickets: Vec>) -> Vec { + let mut itinerary : HashMap> = HashMap::new(); + for (i, ticket) in tickets.iter().enumerate() { + *itinerary.entry(ticket[0].clone()).or_insert(HashMap::new()).entry(ticket[1].clone()).or_insert(0)+=1; + } + + // println!("itinerary={:?}", itinerary); + + let mut route : Vec = vec!["JFK".to_owned()]; + Self::helper(&tickets, &mut itinerary, &mut route); + route + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_332() { + assert_eq!(Solution::find_itinerary(vec![vec_string!["MUC","LHR"],vec_string!["JFK","MUC"],vec_string!["SFO","SJC"],vec_string!["LHR","SFO"]]), vec_string!["JFK","MUC","LHR","SFO","SJC"]); + + + assert_eq!(Solution::find_itinerary(vec![vec_string!["JFK","SFO"],vec_string!["JFK","ATL"],vec_string!["SFO","ATL"],vec_string!["ATL","JFK"],vec_string!["ATL","SFO"]]), vec_string!["JFK","ATL","JFK","SFO","ATL","SFO"]); + + assert_eq!(Solution::find_itinerary(vec![vec_string!["EZE","AXA"],vec_string!["TIA","ANU"],vec_string!["ANU","JFK"],vec_string!["JFK","ANU"],vec_string!["ANU","EZE"],vec_string!["TIA","ANU"],vec_string!["AXA","TIA"],vec_string!["TIA","JFK"],vec_string!["ANU","TIA"],vec_string!["JFK","TIA"]]), vec_string!["JFK","ANU","EZE","AXA","TIA","ANU","JFK","TIA","ANU","TIA","JFK"]); + } + +} diff --git a/src/problem/p0334_increasing_triplet_subsequence.rs b/src/problem/p0334_increasing_triplet_subsequence.rs new file mode 100644 index 00000000..fa02f3f3 --- /dev/null +++ b/src/problem/p0334_increasing_triplet_subsequence.rs @@ -0,0 +1,71 @@ +/** + * [334] Increasing Triplet Subsequence + * + * Given an integer array nums, return true if there exists a triple of indices (i, j, k) such that i < j < k and nums[i] < nums[j] < nums[k]. If no such indices exists, return false. + * + * Example 1: + * + * Input: nums = [1,2,3,4,5] + * Output: true + * Explanation: Any triplet where i < j < k is valid. + * + * Example 2: + * + * Input: nums = [5,4,3,2,1] + * Output: false + * Explanation: No triplet exists. + * + * Example 3: + * + * Input: nums = [2,1,5,0,4,6] + * Output: true + * Explanation: The triplet (3, 4, 5) is valid because nums[3] == 0 < nums[4] == 4 < nums[5] == 6. + * + * + * Constraints: + * + * 1 <= nums.length <= 5 * 10^5 + * -2^31 <= nums[i] <= 2^31 - 1 + * + * + * Follow up: Could you implement a solution that runs in O(n) time complexity and O(1) space complexity? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/increasing-triplet-subsequence/ +// discuss: https://leetcode.com/problems/increasing-triplet-subsequence/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn increasing_triplet(nums: Vec) -> bool { + let mut first : i64 = 1 <<33; + let mut sec : i64 = 1 <<33; + for &num in nums.iter() { + let num = num as i64; + // println!("num={},first={},sec={}", num, first, sec); + if num <= first { + first = num; + } else if num <= sec { + sec = num; + } else { + return true; + } + } + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_334() { + // assert!(Solution::increasing_triplet(vec![1,2,3,4,5])); + // assert!(!Solution::increasing_triplet(vec![5,4,3,2,1])); + assert!(!Solution::increasing_triplet(vec![1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1,1])); + } +} diff --git a/src/problem/p0335_self_crossing.rs b/src/problem/p0335_self_crossing.rs new file mode 100644 index 00000000..bd1dcde5 --- /dev/null +++ b/src/problem/p0335_self_crossing.rs @@ -0,0 +1,72 @@ +/** + * [335] Self Crossing + * + * You are given an array of integers distance. + * You start at point (0,0) on an X-Y plane and you move distance[0] meters to the north, then distance[1] meters to the west, distance[2] meters to the south, distance[3] meters to the east, and so on. In other words, after each move, your direction changes counter-clockwise. + * Return true if your path crosses itself, and false if it does not. + * + * Example 1: + * + * Input: distance = [2,1,1,2] + * Output: true + * + * Example 2: + * + * Input: distance = [1,2,3,4] + * Output: false + * + * Example 3: + * + * Input: distance = [1,1,1,1] + * Output: true + * + * + * Constraints: + * + * 1 <= distance.length <= 500 + * 1 <= distance[i] <= 500 + * + * + * Follow up: Could you write a one-pass algorithm with O(1) extra space? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/self-crossing/ +// discuss: https://leetcode.com/problems/self-crossing/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn is_self_crossing(d: Vec) -> bool { + for i in (0..d.len()) { + if 3 <= i && d[i-2] <= d[i] && d[i-1] <= d[i-3] { + return true; + } + + if 4 <= i && d[i-1] == d[i-3] && d[i] + d[i-4] >= d[i-2] { + return true; + } + + if 5 <= i && d[i-2] > d[i-4] && d[i-4]+d[i]>=d[i-2] && d[i-3]>d[i-1] && d[i-5]+d[i-1]>=d[i-3]{ + return true; + } + + } + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_335() { + assert!(Solution::is_self_crossing(vec![2,1,1,2])); + assert!(!Solution::is_self_crossing(vec![1,2,3,4])); + assert!(Solution::is_self_crossing(vec![1,1,1,1])); + } +} diff --git a/src/problem/p0336_palindrome_pairs.rs b/src/problem/p0336_palindrome_pairs.rs new file mode 100644 index 00000000..a7b34d6e --- /dev/null +++ b/src/problem/p0336_palindrome_pairs.rs @@ -0,0 +1,147 @@ +/** + * [336] Palindrome Pairs + * + * Given a list of unique words, return all the pairs of the distinct indices (i, j) in the given list, so that the concatenation of the two words words[i] + words[j] is a palindrome. + * + * Example 1: + * + * Input: words = ["abcd","dcba","lls","s","sssll"] + * Output: [[0,1],[1,0],[3,2],[2,4]] + * Explanation: The palindromes are ["dcbaabcd","abcddcba","slls","llssssll"] + * + * Example 2: + * + * Input: words = ["bat","tab","cat"] + * Output: [[0,1],[1,0]] + * Explanation: The palindromes are ["battab","tabbat"] + * + * Example 3: + * + * Input: words = ["a",""] + * Output: [[0,1],[1,0]] + * + * + * Constraints: + * + * 1 <= words.length <= 5000 + * 0 <= words[i].length <= 300 + * words[i] consists of lower-case English letters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/palindrome-pairs/ +// discuss: https://leetcode.com/problems/palindrome-pairs/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +struct TrieNode { + branches : Vec>>, + word_index : Option, + suffix_palindrome_indices : Vec, +} + +fn is_palindrome(word : &Vec) -> bool { + if word.len() == 0 {return true} + let mut start = 0usize; + let mut end = word.len() - 1; + while start < end { + if word[start] != word[end] {return false;} + start += 1; + end -= 1; + } + true +} + +impl TrieNode { + pub fn new() -> TrieNode { + TrieNode{branches: (0..26).map(|_|{None}).collect(), + word_index: None, suffix_palindrome_indices: vec![]} + } + + pub fn add_reversed_word(&mut self, word : &Vec, word_idx : usize, level : usize) { + let pad : String = (0..level).map(|_|{" "}).collect(); + println!("{}word={:?}, word_idx={}", pad, word, word_idx); + if word.len() > 0 { + if is_palindrome(word) { + self.suffix_palindrome_indices.push(word_idx); + println!("{} is_palindrome", pad); + } + + let first_char : char = word[0]; + let first_char_pos : usize = (first_char as u8 - 'a' as u8) as usize; + if self.branches[first_char_pos].is_none() { + self.branches[first_char_pos] = Some(Box::new(TrieNode::new())); + } + + let the_rest : Vec = word.iter().skip(1).cloned().collect(); + self.branches[first_char_pos].as_mut().unwrap().add_reversed_word(&the_rest, word_idx, level + 1); + } else { + self.word_index = Some(word_idx); + println!("{} END", pad); + } + + } + + pub fn search(&self, word : &Vec, word_idx : usize, results : &mut Vec>, level : usize) { + let pad : String = (0..level).map(|_|{" "}).collect(); + println!("{}word={:?}, word_idx={}", pad, word, word_idx); + if let Some(matched_index) = self.word_index { + // matched_idx == word_idx if the word itself is a palindrome + // word can be "" if two words are "abc" and "cba", etc. + + if matched_index != word_idx && is_palindrome(word) { + println!("{} reversed_word_idx{}", pad, self.word_index.unwrap()); + results.push(vec![word_idx as i32, self.word_index.unwrap() as i32]); + } + } + + if word.len() > 0 { + let first_char : char = word[0]; + let first_char_pos : usize = (first_char as u8 - 'a' as u8) as usize; + + if self.branches[first_char_pos].is_some() { + let the_rest : Vec = word.iter().skip(1).cloned().collect(); + self.branches[first_char_pos].as_ref().unwrap().search(&the_rest, word_idx, results, level + 1); + } + } else { + println!("{} suffix_palindrome_indices{:?}", pad, self.suffix_palindrome_indices); + + for &idx in self.suffix_palindrome_indices.iter() { + results.push(vec![word_idx as i32, idx as i32]); + } + } + } +} + +impl Solution { + pub fn palindrome_pairs(words: Vec) -> Vec> { + let mut root = TrieNode::new(); + let mut results : Vec> = vec![]; + for (i, word) in words.iter().enumerate() { + let reversed_chars :Vec = word.chars().rev().collect(); + root.add_reversed_word(&reversed_chars, i, 0); + } + println!("============================================="); + for (i, word) in words.iter().enumerate() { + let chars : Vec = word.chars().collect(); + root.search(&chars, i, &mut results, 0); + } + results + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_336() { + assert_eq!(Solution::palindrome_pairs(vec_string!["abcd","dcba","lls","s","sssll"]), vec![vec![0,1],vec![1,0],vec![2,4],vec![3,2]]); + + assert_eq!(Solution::palindrome_pairs(vec_string!["bat","tab","cat"]), vec![vec![0,1],vec![1,0]]); + + assert_eq!(Solution::palindrome_pairs(vec_string!["a", ""]), vec![vec![0,1],vec![1,0]]); + } +} diff --git a/src/problem/p0337_house_robber_iii.rs b/src/problem/p0337_house_robber_iii.rs new file mode 100644 index 00000000..e2ee03ad --- /dev/null +++ b/src/problem/p0337_house_robber_iii.rs @@ -0,0 +1,96 @@ +/** + * [337] House Robber III + * + * The thief has found himself a new place for his thievery again. There is only one entrance to this area, called root. + * Besides the root, each house has one and only one parent house. After a tour, the smart thief realized that all houses in this place form a binary tree. It will automatically contact the police if two directly-linked houses were broken into on the same night. + * Given the root of the binary tree, return the maximum amount of money the thief can rob without alerting the police. + * + * Example 1: + * + * Input: root = [3,2,3,null,3,null,1] + * Output: 7 + * Explanation: Maximum amount of money the thief can rob = 3 + 3 + 1 = 7. + * + * Example 2: + * + * Input: root = [3,4,5,1,3,null,1] + * Output: 9 + * Explanation: Maximum amount of money the thief can rob = 4 + 5 = 9. + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [1, 10^4]. + * 0 <= Node.val <= 10^4 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/house-robber-iii/ +// discuss: https://leetcode.com/problems/house-robber-iii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::{borrow::Borrow, rc::Rc}; +use std::cell::RefCell; +impl Solution { + // return the max for both cases: this node is robbed or not. + pub fn helper(root: Option>>) -> (i32,i32) { + let result = match(root) { + None =>{(0, 0)} + Some(node) => { + let (left_on, left_off) = Self::helper(node.borrow_mut().left.take()); + let (right_on, right_off) = Self::helper(node.borrow_mut().right.take()); + let my_on = (*node).borrow().val + left_off + right_off; + + // Assuming this node is not robbed, it is valid that the child not is either robbed or not. + // So we simply sum up the max of each option in both children nodes. + + let max_left = std::cmp::max(left_on, left_off); + let max_right = std::cmp::max(right_on, right_off); + let my_off = max_left + max_right; + // println!("node({}) = (on: {}, off: {}, left_on: {}, left_off: {}, right_on: {}, right_off: {})", (*node).borrow().val, my_on, my_off, left_on, left_off, right_on, right_off); + (my_on, my_off) + } + }; + result + } + + pub fn rob(root: Option>>) -> i32 { + let (my_on, my_off) = Self::helper(root); + std::cmp::max(my_on, my_off) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_337() { + assert_eq!( + Solution::rob(tree![3,2,3,null,3,null,1]), 7 + ); + } +} diff --git a/src/problem/p0341_flatten_nested_list_iterator.rs b/src/problem/p0341_flatten_nested_list_iterator.rs new file mode 100644 index 00000000..34440660 --- /dev/null +++ b/src/problem/p0341_flatten_nested_list_iterator.rs @@ -0,0 +1,136 @@ +/** + * [341] Flatten Nested List Iterator + * + * You are given a nested list of integers nestedList. Each element is either an integer or a list whose elements may also be integers or other lists. Implement an iterator to flatten it. + * Implement the NestedIterator class: + * + * NestedIterator(List nestedList) Initializes the iterator with the nested list nestedList. + * int next() Returns the next integer in the nested list. + * boolean hasNext() Returns true if there are still some integers in the nested list and false otherwise. + * + * Your code will be tested with the following pseudocode: + * + * initialize iterator with nestedList + * res = [] + * while iterator.hasNext() + * append iterator.next() to the end of res + * return res + * + * If res matches the expected flattened list, then your code will be judged as correct. + * + * Example 1: + * + * Input: nestedList = [[1,1],2,[1,1]] + * Output: [1,1,2,1,1] + * Explanation: By calling next repeatedly until hasNext returns false, the order of elements returned by next should be: [1,1,2,1,1]. + * + * Example 2: + * + * Input: nestedList = [1,[4,[6]]] + * Output: [1,4,6] + * Explanation: By calling next repeatedly until hasNext returns false, the order of elements returned by next should be: [1,4,6]. + * + * + * Constraints: + * + * 1 <= nestedList.length <= 500 + * The values of the integers in the nested list is in the range [-10^6, 10^6]. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/flatten-nested-list-iterator/ +// discuss: https://leetcode.com/problems/flatten-nested-list-iterator/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +#[derive(Debug, PartialEq, Eq)] +pub enum NestedInteger { + Int(i32), + List(Vec) +} + +use std::collections::VecDeque; +struct NestedIterator { + nested_list : VecDeque, +} + + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl NestedIterator { + + fn new(nested_list: Vec) -> Self { + Self{nested_list : nested_list.into_iter().collect()} + } + + fn next(&mut self) -> i32 { + self.expand(); + if !self.has_next() {return 0;} + if let Some(NestedInteger::Int(val)) = self.nested_list.pop_front() { + val + } else { + panic!("The front must be an int due to the previous expand..."); + } + } + + fn expand(&mut self) { + // Assume has_next() is true + while let Some(first_nested_int) = self.nested_list.get(0) { + match(first_nested_int) { + NestedInteger::Int(_)=>{break;} + NestedInteger::List(_) => { + if let Some(NestedInteger::List(first_nested_list)) = self.nested_list.pop_front() { + for nested_int in first_nested_list.into_iter().rev() { + self.nested_list.push_front(nested_int); + } + } else { + + } + } + } + // if let NestedInteger::List(nested_list) = self.nested_list.pop_front().unwrap() { + // for nested_int in nested_list.into_iter().rev() { + // self.nested_list.push_front(nested_int); + // } + // } { + // panic!("Must be a list due to whiel condition"); + // } + } + + } + + fn has_next(&mut self) -> bool { + self.expand(); + self.nested_list.len() != 0 + } +} + +/** + * Your NestedIterator object will be instantiated and called as such: + * let obj = NestedIterator::new(nestedList); + * let ret_1: i32 = obj.next(); + * let ret_2: bool = obj.has_next(); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_341() { + let nested = vec![NestedInteger::List(vec![NestedInteger::Int(1), NestedInteger::Int(1)]), NestedInteger::Int(2), NestedInteger::List(vec![NestedInteger::Int(1), NestedInteger::Int(1)])]; + + let mut iterator = NestedIterator::new(nested); + + let mut res = vec![]; + while iterator.has_next() { + res.push(iterator.next()); + } + assert_eq!(res, vec![1,1,2,1,1]); + } +} diff --git a/src/problem/p0343_integer_break.rs b/src/problem/p0343_integer_break.rs new file mode 100644 index 00000000..cd4cad93 --- /dev/null +++ b/src/problem/p0343_integer_break.rs @@ -0,0 +1,58 @@ +/** + * [343] Integer Break + * + * Given an integer n, break it into the sum of k positive integers, where k >= 2, and maximize the product of those integers. + * Return the maximum product you can get. + * + * Example 1: + * + * Input: n = 2 + * Output: 1 + * Explanation: 2 = 1 + 1, 1 × 1 = 1. + * + * Example 2: + * + * Input: n = 10 + * Output: 36 + * Explanation: 10 = 3 + 3 + 4, 3 × 3 × 4 = 36. + * + * + * Constraints: + * + * 2 <= n <= 58 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/integer-break/ +// discuss: https://leetcode.com/problems/integer-break/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn integer_break(n: i32) -> i32 { + let mut result = vec![1;(n+1) as usize]; + for i in 2..=(n as usize) { + for j in 1..=((i-1) as usize) { + // println!("i={}, j={}, j* result[i-j]={}", i, j, (j as i32) * result[i-j]); + result[i] = std::cmp::max(result[i], (j as i32) * result[i-j]); + result[i] = std::cmp::max(result[i], (j as i32) * (i-j) as i32); + } + // println!("i={}, result[i]={}", i, result[i]); + } + result[n as usize] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_343() { + // assert_eq!(Solution::integer_break(2), 1); + assert_eq!(Solution::integer_break(10), 36); + } +} diff --git a/src/problem/p0347_top_k_frequent_elements.rs b/src/problem/p0347_top_k_frequent_elements.rs new file mode 100644 index 00000000..e57063f8 --- /dev/null +++ b/src/problem/p0347_top_k_frequent_elements.rs @@ -0,0 +1,71 @@ +/** + * [347] Top K Frequent Elements + * + * Given an integer array nums and an integer k, return the k most frequent elements. You may return the answer in any order. + * + * Example 1: + * Input: nums = [1,1,1,2,2,3], k = 2 + * Output: [1,2] + * Example 2: + * Input: nums = [1], k = 1 + * Output: [1] + * + * Constraints: + * + * 1 <= nums.legth <= 10^5 + * k is in the range [1, the number of unique elements in the array]. + * It is guaranteed that the answer is unique. + * + * + * Follow up: Your algorithm's time complexity must be better than O(n log n), where n is the array's size. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/top-k-frequent-elements/ +// discuss: https://leetcode.com/problems/top-k-frequent-elements/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn top_k_frequent(nums: Vec, k: i32) -> Vec { + let mut counts = HashMap::new(); + for &num in &nums { + if let Some(c) = counts.get_mut(&num) { + *c +=1 ; + } else { + counts.insert(num, 1usize); + } + } + + let mut sorted_count = vec![]; + for (num, count) in counts { + sorted_count.push((count, num)); + } + sorted_count.sort(); + + let mut result = vec![]; + let mut start = 0usize; + if (k as usize) < sorted_count.len() { + start = sorted_count.len() - k as usize; + } + + for i in start..sorted_count.len() { + result.push(sorted_count[i].1); + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_347() { + assert_eq!(Solution::top_k_frequent(vec![1,1,1,2,2,3], 2), vec![2,1]); + assert_eq!(Solution::top_k_frequent(vec![1], 1), vec![1]); + } +} diff --git a/src/problem/p0352_data_stream_as_disjoint_intervals.rs b/src/problem/p0352_data_stream_as_disjoint_intervals.rs new file mode 100644 index 00000000..e655bb5e --- /dev/null +++ b/src/problem/p0352_data_stream_as_disjoint_intervals.rs @@ -0,0 +1,119 @@ +/** + * [352] Data Stream as Disjoint Intervals + * + * Given a data stream input of non-negative integers a1, a2, ..., an, summarize the numbers seen so far as a list of disjoint intervals. + * Implement the SummaryRanges class: + * + * SummaryRanges() Initializes the object with an empty stream. + * void addNum(int val) Adds the integer val to the stream. + * int[][] getIntervals() Returns a summary of the integers in the stream currently as a list of disjoint intervals [starti, endi]. + * + * + * Example 1: + * + * Input + * ["SummaryRanges", "addNum", "getIntervals", "addNum", "getIntervals", "addNum", "getIntervals", "addNum", "getIntervals", "addNum", "getIntervals"] + * [[], [1], [], [3], [], [7], [], [2], [], [6], []] + * Output + * [null, null, [[1, 1]], null, [[1, 1], [3, 3]], null, [[1, 1], [3, 3], [7, 7]], null, [[1, 3], [7, 7]], null, [[1, 3], [6, 7]]] + * Explanation + * SummaryRanges summaryRanges = new SummaryRanges(); + * summaryRanges.addNum(1); // arr = [1] + * summaryRanges.getIntervals(); // return [[1, 1]] + * summaryRanges.addNum(3); // arr = [1, 3] + * summaryRanges.getIntervals(); // return [[1, 1], [3, 3]] + * summaryRanges.addNum(7); // arr = [1, 3, 7] + * summaryRanges.getIntervals(); // return [[1, 1], [3, 3], [7, 7]] + * summaryRanges.addNum(2); // arr = [1, 2, 3, 7] + * summaryRanges.getIntervals(); // return [[1, 3], [7, 7]] + * summaryRanges.addNum(6); // arr = [1, 2, 3, 6, 7] + * summaryRanges.getIntervals(); // return [[1, 3], [6, 7]] + * + * + * Constraints: + * + * 0 <= val <= 10^4 + * At most 3 * 10^4 calls will be made to addNum and getIntervals. + * + * + * Follow up: What if there are lots of merges and the number of disjoint intervals is small compared to the size of the data stream? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/data-stream-as-disjoint-intervals/ +// discuss: https://leetcode.com/problems/data-stream-as-disjoint-intervals/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +struct SummaryRanges { + ranges : BTreeMap, +} + +use std::collections::BTreeMap; +use std::ops::RangeToInclusive; +use std::ops::RangeFrom; +use std::ops::RangeFull; + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl SummaryRanges { + + /** Initialize your data structure here. */ + fn new() -> Self { + SummaryRanges{ranges : BTreeMap::new()} + } + + fn add_num(&mut self, val: i32) { + let mut this_start : i32 = val; + if let Some((&left_start, &left_end)) = self.ranges.range(RangeToInclusive{end : val}).next_back() { + if left_end < val - 1 { + // do nothing + } else if left_end == val - 1 { + self.ranges.remove(&left_start).expect("left_start must exists"); + this_start = left_start; + } else { + // this num is already in range. + return + } + }; + + let mut this_end : i32 = val; + if let Some((&right_start, &right_end)) = self.ranges.range(RangeFrom{start : val}).next() { + if right_start == val + 1 { + self.ranges.remove(&right_start).expect("right_start must exists"); + this_end = right_end; + } + }; + + self.ranges.insert(this_start, this_end); + } + + fn get_intervals(&self) -> Vec> { + let mut result = vec![]; + for (&start, &end) in self.ranges.range(RangeFull) { + result.push(vec![start, end]); + } + result + } +} + +/** + * Your SummaryRanges object will be instantiated and called as such: + * let obj = SummaryRanges::new(); + * obj.add_num(val); + * let ret_2: Vec> = obj.get_intervals(); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_352() { + } +} diff --git a/src/problem/p0354_russian_doll_envelopes.rs b/src/problem/p0354_russian_doll_envelopes.rs new file mode 100644 index 00000000..e3009f23 --- /dev/null +++ b/src/problem/p0354_russian_doll_envelopes.rs @@ -0,0 +1,95 @@ +/** + * [354] Russian Doll Envelopes + * + * You are given a 2D array of integers envelopes where envelopes[i] = [wi, hi] represents the width and the height of an envelope. + * One envelope can fit into another if and only if both the width and height of one envelope are greater than the other envelope's width and height. + * Return the maximum number of envelopes you can Russian doll (i.e., put one inside the other). + * Note: You cannot rotate an envelope. + * + * Example 1: + * + * Input: envelopes = [[5,4],[6,4],[6,7],[2,3]] + * Output: 3 + * Explanation: The maximum number of envelopes you can Russian doll is 3 ([2,3] => [5,4] => [6,7]). + * + * Example 2: + * + * Input: envelopes = [[1,1],[1,1],[1,1]] + * Output: 1 + * + * + * Constraints: + * + * 1 <= envelopes.length <= 5000 + * envelopes[i].length == 2 + * 1 <= wi, hi <= 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/russian-doll-envelopes/ +// discuss: https://leetcode.com/problems/russian-doll-envelopes/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_last_smaller(lasts : &Vec, height : i32) -> i32 { + let mut start : i32 = 0; + let mut end : i32 = lasts.len() as i32 - 1; + while start <= end { + let mid : usize = (start + (end - start) / 2) as usize; + if lasts[mid] < height { + if mid == lasts.len() - 1 || !(lasts[mid+1] < height) { + return mid as i32; + } else { + start = mid as i32 + 1; + } + } else { + end = mid as i32 - 1; + } + } + -1i32 + } + + pub fn max_envelopes(mut envelopes: Vec>) -> i32 { + // sort by ascending width then descending height if equal width + envelopes.sort_by(|a,b|{ + if a[0] < b[0] { + std::cmp::Ordering::Less + } else if a[0] > b[0] { + std::cmp::Ordering::Greater + } else if a[1] <= b[1] { + std::cmp::Ordering::Greater + } else { + std::cmp::Ordering::Less + } + }); + + // longest increasing subsequence with respect to height + let mut lasts : Vec = vec![]; + for envelope in envelopes.iter() { + let height : i32 = envelope[1]; + let last_smaller_pos : i32 = Self::find_last_smaller(&lasts, height); + let new_pos : usize = (last_smaller_pos + 1) as usize; + if new_pos == lasts.len() { + lasts.push(height) + } else { + lasts[new_pos] = height; + } + } + lasts.len() as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_354() { + assert_eq!(Solution::max_envelopes(vec![vec![5,4],vec![6,4],vec![6,7],vec![2,3]]), 3); + assert_eq!(Solution::max_envelopes(vec![vec![1,1],vec![1,1],vec![1,1]]), 1); + } +} diff --git a/src/problem/p0355_design_twitter.rs b/src/problem/p0355_design_twitter.rs new file mode 100644 index 00000000..396ef1b3 --- /dev/null +++ b/src/problem/p0355_design_twitter.rs @@ -0,0 +1,150 @@ +/** + * [355] Design Twitter + * + * Design a simplified version of Twitter where users can post tweets, follow/unfollow another user, and is able to see the 10 most recent tweets in the user's news feed. + * Implement the Twitter class: + * + * Twitter() Initializes your twitter object. + * void postTweet(int userId, int tweetId) Composes a new tweet with ID tweetId by the user userId. Each call to this function will be made with a unique tweetId. + * List getNewsFeed(int userId) Retrieves the 10 most recent tweet IDs in the user's news feed. Each item in the news feed must be posted by users who the user followed or by the user themself. Tweets must be ordered from most recent to least recent. + * void follow(int followerId, int followeeId) The user with ID followerId started following the user with ID followeeId. + * void unfollow(int followerId, int followeeId) The user with ID followerId started unfollowing the user with ID followeeId. + * + * + * Example 1: + * + * Input + * ["Twitter", "postTweet", "getNewsFeed", "follow", "postTweet", "getNewsFeed", "unfollow", "getNewsFeed"] + * [[], [1, 5], [1], [1, 2], [2, 6], [1], [1, 2], [1]] + * Output + * [null, null, [5], null, null, [6, 5], null, [5]] + * Explanation + * Twitter twitter = new Twitter(); + * twitter.postTweet(1, 5); // User 1 posts a new tweet (id = 5). + * twitter.getNewsFeed(1); // User 1's news feed should return a list with 1 tweet id -> [5]. return [5] + * twitter.follow(1, 2); // User 1 follows user 2. + * twitter.postTweet(2, 6); // User 2 posts a new tweet (id = 6). + * twitter.getNewsFeed(1); // User 1's news feed should return a list with 2 tweet ids -> [6, 5]. Tweet id 6 should precede tweet id 5 because it is posted after tweet id 5. + * twitter.unfollow(1, 2); // User 1 unfollows user 2. + * twitter.getNewsFeed(1); // User 1's news feed should return a list with 1 tweet id -> [5], since user 1 is no longer following user 2. + * + * + * Constraints: + * + * 1 <= userId, followerId, followeeId <= 500 + * 0 <= tweetId <= 10^4 + * All the tweets have unique IDs. + * At most 3 * 10^4 calls will be made to postTweet, getNewsFeed, follow, and unfollow. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/design-twitter/ +// discuss: https://leetcode.com/problems/design-twitter/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::collections::HashMap; +use std::collections::HashSet; +use std::collections::VecDeque; +use std::collections::BinaryHeap; + +struct Twitter { + follows : HashMap>, + tweets : HashMap>, + tweet_counter : usize, +} + + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl Twitter { + + /** Initialize your data structure here. */ + fn new() -> Self { + Self{follows: HashMap::new(), tweets: HashMap::new(), tweet_counter: 0} + } + + /** Compose a new tweet. */ + fn post_tweet(&mut self, user_id: i32, tweet_id: i32) { + self.follows.entry(user_id).or_insert([user_id].iter().cloned().collect()); + + self.tweets.entry(user_id).or_insert(VecDeque::new()).push_back((self.tweet_counter, tweet_id)); + self.tweet_counter+=1; + if self.tweets[&user_id].len() > 10 { + self.tweets.get_mut(&user_id).unwrap().pop_front(); + } + } + + /** Retrieve the 10 most recent tweet ids in the user's news feed. Each item in the news feed must be posted by users who the user followed or by the user herself. Tweets must be ordered from most recent to least recent. */ + fn get_news_feed(&mut self, user_id: i32) -> Vec { + if self.follows.get(&user_id).is_none() {return vec![];} + + let mut result : Vec = vec![]; + // (tweet counter, user_id, user_tweet_idx) + let mut recent_tweets : BinaryHeap<(usize, i32, usize)> = BinaryHeap::new(); + for &followee_id in self.follows.get(&user_id).unwrap().iter() { + if let Some(tweet_infos) = self.tweets.get(&followee_id) { + let last_tweet_idx : usize = tweet_infos.len() - 1; + let last_tweet_counter : usize = tweet_infos[last_tweet_idx].0; + recent_tweets.push((last_tweet_counter, followee_id, last_tweet_idx)); + } + } + + while result.len() < 10 { + if let Some((_, user_id, mut user_tweet_idx)) = recent_tweets.pop() { + result.push(self.tweets[&user_id][user_tweet_idx].1); + if user_tweet_idx > 0 { + user_tweet_idx -= 1; + let user_tweet_counter : usize = self.tweets[&user_id][user_tweet_idx].0; + recent_tweets.push((user_tweet_counter, user_id, user_tweet_idx)); + } + } else { + break; + } + } + result + } + + /** Follower follows a followee. If the operation is invalid, it should be a no-op. */ + fn follow(&mut self, follower_id: i32, followee_id: i32) { + self.follows.entry(follower_id).or_insert([follower_id].iter().cloned().collect()).insert(followee_id); + } + + /** Follower unfollows a followee. If the operation is invalid, it should be a no-op. */ + fn unfollow(&mut self, follower_id: i32, followee_id: i32) { + if let Some(followees) = self.follows.get_mut(&follower_id) { + followees.remove(&followee_id); + } + } +} + +/** + * Your Twitter object will be instantiated and called as such: + * let obj = Twitter::new(); + * obj.post_tweet(userId, tweetId); + * let ret_2: Vec = obj.get_news_feed(userId); + * obj.follow(followerId, followeeId); + * obj.unfollow(followerId, followeeId); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_355() { + let mut twitter = Twitter::new(); + twitter.post_tweet(1, 5); // User 1 posts a new tweet (id = 5). + assert_eq!(twitter.get_news_feed(1), vec![5]); // User 1's news feed should return a list with 1 tweet id -> [5]. return [5] + twitter.follow(1, 2); // User 1 follows user 2. + twitter.post_tweet(2, 6); // User 2 posts a new tweet (id = 6). + assert_eq!(twitter.get_news_feed(1), vec![6,5]); // User 1's news feed should return a list with 2 tweet ids -> [6, 5]. Tweet id 6 should precede tweet id 5 because it is posted after tweet id 5. + twitter.unfollow(1, 2); // User 1 unfollows user 2. + assert_eq!(twitter.get_news_feed(1), vec![5]); // User 1's news feed should return a list with 1 tweet id -> [5], since user 1 is no longer following user 2. + } +} diff --git a/src/problem/p0357_count_numbers_with_unique_digits.rs b/src/problem/p0357_count_numbers_with_unique_digits.rs new file mode 100644 index 00000000..c06d62f6 --- /dev/null +++ b/src/problem/p0357_count_numbers_with_unique_digits.rs @@ -0,0 +1,55 @@ +/** + * [357] Count Numbers with Unique Digits + * + * Given an integer n, return the count of all numbers with unique digits, x, where 0 <= x < 10^n. + * + * Example 1: + * + * Input: n = 2 + * Output: 91 + * Explanation: The answer should be the total numbers in the range of 0 ≤ x < 100, excluding 11,22,33,44,55,66,77,88,99 + * + * Example 2: + * + * Input: n = 0 + * Output: 1 + * + * + * Constraints: + * + * 0 <= n <= 8 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/count-numbers-with-unique-digits/ +// discuss: https://leetcode.com/problems/count-numbers-with-unique-digits/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn count_numbers_with_unique_digits(n: i32) -> i32 { + if n == 0 {return 1} + let n : usize = n as usize; + let mut s = Solution::count_numbers_with_unique_digits(n as i32 - 1); + let mut base : i32 = 9; + for i in 1..n { + base *= (10 - i as i32); + } + s+base + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_357() { + // assert_eq!(Solution::count_numbers_with_unique_digits(0), 1); + assert_eq!(Solution::count_numbers_with_unique_digits(1), 10); + // assert_eq!(Solution::count_numbers_with_unique_digits(2), 91); + } +} diff --git a/src/problem/p0363_max_sum_of_rectangle_no_larger_than_k.rs b/src/problem/p0363_max_sum_of_rectangle_no_larger_than_k.rs new file mode 100644 index 00000000..436f0744 --- /dev/null +++ b/src/problem/p0363_max_sum_of_rectangle_no_larger_than_k.rs @@ -0,0 +1,135 @@ +/** + * [363] Max Sum of Rectangle No Larger Than K + * + * Given an m x n matrix matrix and an integer k, return the max sum of a rectangle in the matrix such that its sum is no larger than k. + * It is guaranteed that there will be a rectangle with a sum no larger than k. + * + * Example 1: + * + * Input: matrix = [[1,0,1],[0,-2,3]], k = 2 + * Output: 2 + * Explanation: Because the sum of the blue rectangle [[0, 1], [-2, 3]] is 2, and 2 is the max number no larger than k (k = 2). + * + * Example 2: + * + * Input: matrix = [[2,2,-1]], k = 3 + * Output: 3 + * + * + * Constraints: + * + * m == matrix.length + * n == matrix[i].length + * 1 <= m, n <= 100 + * -100 <= matrix[i][j] <= 100 + * -10^5 <= k <= 10^5 + * + * + * Follow up: What if the number of rows is much larger than the number of columns? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/max-sum-of-rectangle-no-larger-than-k/ +// discuss: https://leetcode.com/problems/max-sum-of-rectangle-no-larger-than-k/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn last_le_pos(sorted : &Vec, target : i32) -> i32 { + let mut start : i32 = 0; + let mut end : i32 = sorted.len() as i32 - 1; + while start <= end { + let mid : usize = (start + (end - start) / 2) as usize; + if sorted[mid] <= target { + if mid == sorted.len() - 1 || !(sorted[mid+1] <= target) { + return mid as i32; + } else { + start = mid as i32 + 1; + } + } else { + end = mid as i32 - 1; + } + } + -1i32 + } + + pub fn compute_while_mergesort(mut prefix_sums : Vec, k : i32, result : &mut i32) -> Vec { + let n : usize = prefix_sums.len(); + if n >= 2 { + let mut sorted_right : Vec = Self::compute_while_mergesort(prefix_sums.split_off(n/2), k, result); + let mut sorted_left : Vec = Self::compute_while_mergesort(prefix_sums, k, result); + + let mut reverse_sorted : Vec = vec![]; + + for &left_num in sorted_left.iter() { + let pos : i32 = Self::last_le_pos(&sorted_right, k + left_num); + if pos != -1 { + *result = std::cmp::max(*result, sorted_right[pos as usize] - left_num); + } + } + + while sorted_left.len() != 0 || sorted_right.len() != 0 { + if sorted_right.len() == 0 || sorted_left.len() != 0 && *sorted_left.last().unwrap() > *sorted_right.last().unwrap() { + reverse_sorted.push(sorted_left.pop().unwrap()); + } else { + reverse_sorted.push(sorted_right.pop().unwrap()); + } + } + reverse_sorted.into_iter().rev().collect() + } else { + prefix_sums + } + } + + pub fn greatest_subarray_le_target(nums : &Vec, k : i32) -> i32 { + let mut cur_prefix_sum : i32 = 0; + let mut prefix_sums : Vec = vec![0]; + + for &num in nums.iter() { + cur_prefix_sum += num; + prefix_sums.push(cur_prefix_sum); + } + let mut result : i32 = -10000; + Self::compute_while_mergesort(prefix_sums, k, &mut result); + result + } + + pub fn max_sum_submatrix(matrix: Vec>, k: i32) -> i32 { + let row_count : usize = matrix.len(); + let col_count : usize = matrix[0].len(); + + let mut result : i32 = -10000; + for left in 0..col_count { + let mut col_sums : Vec = vec![0; row_count]; + for right in left..col_count { + // col_sums for each row from left(inclusive) to right(inclusive) + for i in 0..row_count { + col_sums[i] += matrix[i][right] + } + + // may apply Kadane's Alg to find the max subarray in col_sums, and then max for the sub-matrix for each left and right. + + // here, we find the subarray with greater sum <= k. + let this_result = Self::greatest_subarray_le_target(&col_sums, k); + // println!("left={}, right={}, col_sums={:?}, this_max={}", left, right, col_sums, this_result); + result = std::cmp::max(result, this_result); + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_363() { + // assert_eq!(Solution::max_sum_submatrix(vec![vec![1,0,1],vec![0,-2,3]], 2), 2); + // assert_eq!(Solution::max_sum_submatrix(vec![vec![2,2,-1]], 3), 3); + assert_eq!(Solution::max_sum_submatrix(vec![vec![2,2,-1]], 0), -1); + } +} diff --git a/src/problem/p0365_water_and_jug_problem.rs b/src/problem/p0365_water_and_jug_problem.rs new file mode 100644 index 00000000..1acf0dd4 --- /dev/null +++ b/src/problem/p0365_water_and_jug_problem.rs @@ -0,0 +1,72 @@ +/** + * [365] Water and Jug Problem + * + * You are given two jugs with capacities jug1Capacity and jug2Capacity liters. There is an infinite amount of water supply available. Determine whether it is possible to measure exactly targetCapacity liters using these two jugs. + * If targetCapacity liters of water are measurable, you must have targetCapacity liters of water contained within one or both buckets by the end. + * Operations allowed: + * + * Fill any of the jugs with water. + * Empty any of the jugs. + * Pour water from one jug into another till the other jug is completely full, or the first jug itself is empty. + * + * + * Example 1: + * + * Input: jug1Capacity = 3, jug2Capacity = 5, targetCapacity = 4 + * Output: true + * Explanation: The famous Die Hard example + * + * Example 2: + * + * Input: jug1Capacity = 2, jug2Capacity = 6, targetCapacity = 5 + * Output: false + * + * Example 3: + * + * Input: jug1Capacity = 1, jug2Capacity = 2, targetCapacity = 3 + * Output: true + * + * + * Constraints: + * + * 1 <= jug1Capacity, jug2Capacity, targetCapacity <= 10^6 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/water-and-jug-problem/ +// discuss: https://leetcode.com/problems/water-and-jug-problem/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn gcd(a : i32, b : i32) -> i32 { + if a < b { + Self::gcd(b,a) + } else if b == 0 { + a + } else { + Self::gcd(b, a%b) + } + } + pub fn can_measure_water(jug1_capacity: i32, jug2_capacity: i32, target_capacity: i32) -> bool { + if jug1_capacity + jug2_capacity < target_capacity { + false + } else if jug1_capacity == target_capacity || jug2_capacity == target_capacity { + true + } else { + (target_capacity % Self::gcd(jug1_capacity, jug2_capacity)) == 0 + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_365() { + } +} diff --git a/src/problem/p0368_largest_divisible_subset.rs b/src/problem/p0368_largest_divisible_subset.rs new file mode 100644 index 00000000..ee6d524f --- /dev/null +++ b/src/problem/p0368_largest_divisible_subset.rs @@ -0,0 +1,90 @@ +/** + * [368] Largest Divisible Subset + * + * Given a set of distinct positive integers nums, return the largest subset answer such that every pair (answer[i], answer[j]) of elements in this subset satisfies: + * + * answer[i] % answer[j] == 0, or + * answer[j] % answer[i] == 0 + * + * If there are multiple solutions, return any of them. + * + * Example 1: + * + * Input: nums = [1,2,3] + * Output: [1,2] + * Explanation: [1,3] is also accepted. + * + * Example 2: + * + * Input: nums = [1,2,4,8] + * Output: [1,2,4,8] + * + * + * Constraints: + * + * 1 <= nums.length <= 1000 + * 1 <= nums[i] <= 2 * 10^9 + * All the integers in nums are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/largest-divisible-subset/ +// discuss: https://leetcode.com/problems/largest-divisible-subset/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn largest_divisible_subset(mut nums: Vec) -> Vec { + nums.sort(); + const NONE : Option = None; + let l : usize = nums.len(); + // the size of the largest divisible subset of nums[0..=i], which must include nums[i] + let mut subset_sizes : Vec = vec![1;l]; + let mut lasts : Vec> = vec![NONE;l]; + + let mut largest_pos : usize = 0; + let mut largest_size : usize = 0; + + for (i, &num) in nums.iter().enumerate() { + let mut prev_largest_size : usize = 0; + let mut prev_largest_pos : Option = None; + for j in 0..i { + if num % nums[j] == 0 && subset_sizes[j] > prev_largest_size { + prev_largest_size = subset_sizes[j]; + prev_largest_pos = Some(j); + } + } + subset_sizes[i] = prev_largest_size + 1; + lasts[i] = prev_largest_pos; + + if subset_sizes[i] > largest_size { + largest_size = subset_sizes[i]; + largest_pos = i; + } + } + + let mut r : Vec = vec![nums[largest_pos]]; + let mut cur_pos : usize = largest_pos; + while let Some(next_pos) = lasts[cur_pos] { + r.push(nums[next_pos]); + cur_pos = next_pos; + } + + r.into_iter().rev().collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_368() { + assert_eq!(Solution::largest_divisible_subset(vec![1,2,3]), vec![1,2]); + assert_eq!(Solution::largest_divisible_subset(vec![1,2,4,8]), vec![1,2,4,8]); + assert_eq!(Solution::largest_divisible_subset(vec![1,2,4,6,8]), vec![1,2,4,8]); + } +} diff --git a/src/problem/p0371_sum_of_two_integers.rs b/src/problem/p0371_sum_of_two_integers.rs new file mode 100644 index 00000000..b5328259 --- /dev/null +++ b/src/problem/p0371_sum_of_two_integers.rs @@ -0,0 +1,51 @@ +/** + * [371] Sum of Two Integers + * + * Given two integers a and b, return the sum of the two integers without using the operators + and -. + * + * Example 1: + * Input: a = 1, b = 2 + * Output: 3 + * Example 2: + * Input: a = 2, b = 3 + * Output: 5 + * + * Constraints: + * + * -1000 <= a, b <= 1000 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/sum-of-two-integers/ +// discuss: https://leetcode.com/problems/sum-of-two-integers/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn get_sum(mut a: i32, mut b: i32) -> i32 { + if a == 0 { + b + } else if b == 0 { + a + } else { + while b != 0 { + let carry = a & b; + a ^= b; + b = carry << 1; + } + a + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_371() { + } +} diff --git a/src/problem/p0372_super_pow.rs b/src/problem/p0372_super_pow.rs new file mode 100644 index 00000000..0cdd8066 --- /dev/null +++ b/src/problem/p0372_super_pow.rs @@ -0,0 +1,69 @@ +/** + * [372] Super Pow + * + * Your task is to calculate a^b mod 1337 where a is a positive integer and b is an extremely large positive integer given in the form of an array. + * + * Example 1: + * Input: a = 2, b = [3] + * Output: 8 + * Example 2: + * Input: a = 2, b = [1,0] + * Output: 1024 + * Example 3: + * Input: a = 1, b = [4,3,3,8,5,2] + * Output: 1 + * Example 4: + * Input: a = 2147483647, b = [2,0,0] + * Output: 1198 + * + * Constraints: + * + * 1 <= a <= 2^31 - 1 + * 1 <= b.length <= 2000 + * 0 <= b[i] <= 9 + * b doesn't contain leading zeros. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/super-pow/ +// discuss: https://leetcode.com/problems/super-pow/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +const MODULAR : i64 = 1337; +impl Solution { + pub fn pow_mod_abase(base : i64, power : usize) -> i64 { + let mut r : i64 = 1; + for _ in 0..power { + r = (r * base) % MODULAR; + } + r + } + pub fn helper(a: i64, b: &Vec, cur_pos : usize) -> i64 { + if cur_pos == b.len() {return 1} + let this_num : i64 = b[b.len() - 1 - cur_pos]; + let prev : i64 = Self::helper(a, b, cur_pos + 1); + let prev : i64 = Self::pow_mod_abase(prev, 10); + let this_num : i64 = Self::pow_mod_abase(a,this_num as usize); + (prev * this_num) % MODULAR + } + + pub fn super_pow(a: i32, b: Vec) -> i32 { + Self::helper(a as i64, &b.into_iter().map(|x|{x as i64}).collect(), 0) as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_372() { + assert_eq!(Solution::super_pow(2, vec![3]), 8); + assert_eq!(Solution::super_pow(2, vec![1,0]), 1024); + assert_eq!(Solution::super_pow(1, vec![4,3,3,8,5,2]), 1); + assert_eq!(Solution::super_pow(2147483647, vec![2,0,0]), 1198); + } +} diff --git a/src/problem/p0373_find_k_pairs_with_smallest_sums.rs b/src/problem/p0373_find_k_pairs_with_smallest_sums.rs new file mode 100644 index 00000000..dfd59803 --- /dev/null +++ b/src/problem/p0373_find_k_pairs_with_smallest_sums.rs @@ -0,0 +1,90 @@ +/** + * [373] Find K Pairs with Smallest Sums + * + * You are given two integer arrays nums1 and nums2 sorted in ascending order and an integer k. + * Define a pair (u, v) which consists of one element from the first array and one element from the second array. + * Return the k pairs (u1, v1), (u2, v2), ..., (uk, vk) with the smallest sums. + * + * Example 1: + * + * Input: nums1 = [1,7,11], nums2 = [2,4,6], k = 3 + * Output: [[1,2],[1,4],[1,6]] + * Explanation: The first 3 pairs are returned from the sequence: [1,2],[1,4],[1,6],[7,2],[7,4],[11,2],[7,6],[11,4],[11,6] + * + * Example 2: + * + * Input: nums1 = [1,1,2], nums2 = [1,2,3], k = 2 + * Output: [[1,1],[1,1]] + * Explanation: The first 2 pairs are returned from the sequence: [1,1],[1,1],[1,2],[2,1],[1,2],[2,2],[1,3],[1,3],[2,3] + * + * Example 3: + * + * Input: nums1 = [1,2], nums2 = [3], k = 3 + * Output: [[1,3],[2,3]] + * Explanation: All possible pairs are returned from the sequence: [1,3],[2,3] + * + * + * Constraints: + * + * 1 <= nums1.length, nums2.length <= 10^4 + * -10^9 <= nums1[i], nums2[i] <= 10^9 + * nums1 and nums2 both are sorted in ascending order. + * 1 <= k <= 1000 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/find-k-pairs-with-smallest-sums/ +// discuss: https://leetcode.com/problems/find-k-pairs-with-smallest-sums/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::collections::BinaryHeap; +impl Solution { + pub fn k_smallest_pairs(nums1: Vec, nums2: Vec, k: i32) -> Vec> { + // if nums1.len() > nums2.len() { + // return Self::k_smallest_pairs(nums2, nums1, k); + // } + let k : usize = k as usize; + let mut last1 : usize = 0; + let mut last2 : usize = 0; + let mut r = vec![]; + + // (-sum, pos1, pos2) + let mut heap : BinaryHeap<(i32, usize, usize)> = BinaryHeap::new(); + for i in 0..nums1.len() { + let sum : i32 = nums1[i] + nums2[0]; + heap.push((-sum, i, 0)); + } + + while let Some(smallest) = heap.pop() { + let num1_pos : usize = smallest.1; + let num2_pos : usize = smallest.2; + r.push(vec![nums1[num1_pos], nums2[num2_pos]]); + if r.len() == k {break;} + + if num2_pos < nums2.len() - 1 { + let nums2_next_pos : usize = num2_pos + 1; + let sum : i32 = nums1[num1_pos] + nums2[nums2_next_pos]; + heap.push((-sum, num1_pos, nums2_next_pos)); + } + } + r + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_373() { + assert_eq!(Solution::k_smallest_pairs(vec![1,7,11], vec![2,4,6], 3), vec![vec![1,2],vec![1,4],vec![1,6]]); + + assert_eq!(Solution::k_smallest_pairs(vec![1,1,2], vec![1,2,3], 2), vec![vec![1,1],vec![1,1]]); + + assert_eq!(Solution::k_smallest_pairs(vec![1,2], vec![3], 3), vec![vec![1,3],vec![2,3]]); + } +} diff --git a/src/problem/p0375_guess_number_higher_or_lower_ii.rs b/src/problem/p0375_guess_number_higher_or_lower_ii.rs new file mode 100644 index 00000000..fe2c3489 --- /dev/null +++ b/src/problem/p0375_guess_number_higher_or_lower_ii.rs @@ -0,0 +1,101 @@ +/** + * [375] Guess Number Higher or Lower II + * + * We are playing the Guessing Game. The game will work as follows: + *
    + * I pick a number between 1 and n. + * You guess a number. + * If you guess the right number, you win the game. + * If you guess the wrong number, then I will tell you whether the number I picked is higher or lower, and you will continue guessing. + * Every time you guess a wrong number x, you will pay x dollars. If you run out of money, you lose the game. + *
+ * Given a particular n, return the minimum amount of money you need to guarantee a win regardless of what number I pick. + * + * Example 1: + * + * Input: n = 10 + * Output: 16 + * Explanation: The winning strategy is as follows: + * - The range is [1,10]. Guess 7. + * - If this is my number, your total is $0. Otherwise, you pay $7. + * - If my number is higher, the range is [8,10]. Guess 9. + * - If this is my number, your total is $7. Otherwise, you pay $9. + * - If my number is higher, it must be 10. Guess 10. Your total is $7 + $9 = $16. + * - If my number is lower, it must be 8. Guess 8. Your total is $7 + $9 = $16. + * - If my number is lower, the range is [1,6]. Guess 3. + * - If this is my number, your total is $7. Otherwise, you pay $3. + * - If my number is higher, the range is [4,6]. Guess 5. + * - If this is my number, your total is $7 + $3 = $10. Otherwise, you pay $5. + * - If my number is higher, it must be 6. Guess 6. Your total is $7 + $3 + $5 = $15. + * - If my number is lower, it must be 4. Guess 4. Your total is $7 + $3 + $5 = $15. + * - If my number is lower, the range is [1,2]. Guess 1. + * - If this is my number, your total is $7 + $3 = $10. Otherwise, you pay $1. + * - If my number is higher, it must be 2. Guess 2. Your total is $7 + $3 + $1 = $11. + * The worst case in all these scenarios is that you pay $16. Hence, you only need $16 to guarantee a win. + * + * Example 2: + * + * Input: n = 1 + * Output: 0 + * Explanation: There is only one possible number, so you can guess 1 and not have to pay anything. + * + * Example 3: + * + * Input: n = 2 + * Output: 1 + * Explanation: There are two possible numbers, 1 and 2. + * - Guess 1. + * - If this is my number, your total is $0. Otherwise, you pay $1. + * - If my number is higher, it must be 2. Guess 2. Your total is $1. + * The worst case is that you pay $1. + * + * + * Constraints: + * + * 1 <= n <= 200 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/guess-number-higher-or-lower-ii/ +// discuss: https://leetcode.com/problems/guess-number-higher-or-lower-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn helper(start : i32, end : i32, cache : &mut HashMap<(i32, i32), i32>) -> i32 { + // start, end both inclusive + if start >= end { + 0 + } else if let Some(&cached) = cache.get(&(start, end)) { + cached + } else { + let mut min_cost : i32 = 1<<30; + for guess in start..=end { + let this_cost = guess + std::cmp::max(Self::helper(start, guess-1, cache), Self::helper(guess+1, end, cache)); + min_cost = std::cmp::min(min_cost, this_cost); + } + cache.insert((start, end), min_cost); + min_cost + } + } + + pub fn get_money_amount(n: i32) -> i32 { + let mut cache : HashMap<(i32, i32), i32> = HashMap::new(); + Self::helper(1, n, &mut cache) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_375() { + assert_eq!(Solution::get_money_amount(1), 0); + assert_eq!(Solution::get_money_amount(2), 1); + assert_eq!(Solution::get_money_amount(10), 16); + } +} diff --git a/src/problem/p0376_wiggle_subsequence.rs b/src/problem/p0376_wiggle_subsequence.rs new file mode 100644 index 00000000..3640ee00 --- /dev/null +++ b/src/problem/p0376_wiggle_subsequence.rs @@ -0,0 +1,90 @@ +/** + * [376] Wiggle Subsequence + * + * A wiggle sequence is a sequence where the differences between successive numbers strictly alternate between positive and negative. The first difference (if one exists) may be either positive or negative. A sequence with one element and a sequence with two non-equal elements are trivially wiggle sequences. + * + * For example, [1, 7, 4, 9, 2, 5] is a wiggle sequence because the differences (6, -3, 5, -7, 3) alternate between positive and negative. + * In contrast, [1, 4, 7, 2, 5] and [1, 7, 4, 5, 5] are not wiggle sequences. The first is not because its first two differences are positive, and the second is not because its last difference is zero. + * + * A subsequence is obtained by deleting some elements (possibly zero) from the original sequence, leaving the remaining elements in their original order. + * Given an integer array nums, return the length of the longest wiggle subsequence of nums. + * + * Example 1: + * + * Input: nums = [1,7,4,9,2,5] + * Output: 6 + * Explanation: The entire sequence is a wiggle sequence with differences (6, -3, 5, -7, 3). + * + * Example 2: + * + * Input: nums = [1,17,5,10,13,15,10,5,16,8] + * Output: 7 + * Explanation: There are several subsequences that achieve this length. + * One is [1, 17, 10, 13, 10, 16, 8] with differences (16, -7, 3, -3, 6, -8). + * + * Example 3: + * + * Input: nums = [1,2,3,4,5,6,7,8,9] + * Output: 2 + * + * + * Constraints: + * + * 1 <= nums.length <= 1000 + * 0 <= nums[i] <= 1000 + * + * + * Follow up: Could you solve this in O(n) time? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/wiggle-subsequence/ +// discuss: https://leetcode.com/problems/wiggle-subsequence/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn wiggle_max_length(nums: Vec) -> i32 { + let mut low_count : i32 = 1; + let mut high_count : i32 = 1; + let mut last_low : i32 = nums[0]; + let mut last_high : i32 = nums[0]; + + for i in 1..nums.len() { + let prev_last_low = last_low; + let prev_last_high = last_high; + let prev_low_count : i32 = low_count; + let prev_high_count : i32 = high_count; + + if nums[i] > prev_last_low { + last_high = nums[i]; + high_count = prev_low_count + 1; + } else { + last_low = nums[i]; // make it easier to wiggle in later iterations. + } + + if nums[i] < prev_last_high { + last_low = nums[i]; + low_count = prev_high_count + 1; + } else { + last_high = nums[i]; // make it easier to wiggle in later iteration + } + } + std::cmp::max(low_count, high_count) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_376() { + assert_eq!(Solution::wiggle_max_length(vec![1,7,4,9,2,5]), 6); + assert_eq!(Solution::wiggle_max_length(vec![1,17,5,10,13,15,10,5,16,8]), 7); + assert_eq!(Solution::wiggle_max_length(vec![1,2,3,4,5,6,7,8,9]), 2); + } +} diff --git a/src/problem/p0377_combination_sum_iv.rs b/src/problem/p0377_combination_sum_iv.rs new file mode 100644 index 00000000..72ea3d8d --- /dev/null +++ b/src/problem/p0377_combination_sum_iv.rs @@ -0,0 +1,80 @@ +/** + * [377] Combination Sum IV + * + * Given an array of distinct integers nums and a target integer target, return the number of possible combinations that add up to target. + * The answer is guaranteed to fit in a 32-bit integer. + * + * Example 1: + * + * Input: nums = [1,2,3], target = 4 + * Output: 7 + * Explanation: + * The possible combination ways are: + * (1, 1, 1, 1) + * (1, 1, 2) + * (1, 2, 1) + * (1, 3) + * (2, 1, 1) + * (2, 2) + * (3, 1) + * Note that different sequences are counted as different combinations. + * + * Example 2: + * + * Input: nums = [9], target = 3 + * Output: 0 + * + * + * Constraints: + * + * 1 <= nums.length <= 200 + * 1 <= nums[i] <= 1000 + * All the elements of nums are unique. + * 1 <= target <= 1000 + * + * + * Follow up: What if negative numbers are allowed in the given array? How does it change the problem? What limitation we need to add to the question to allow negative numbers? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/combination-sum-iv/ +// discuss: https://leetcode.com/problems/combination-sum-iv/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn helper(nums : &Vec, target : i32, cache : &mut HashMap) -> i32 { + if target < 0 { + 0 + } else if target == 0 { + 1 + } else if let Some(&cached) = cache.get(&target) { + cached + } else { + let mut r : i32 = 0; + for &num in nums.iter() { + r += Self::helper(nums, target - num, cache); + } + cache.insert(target, r); + r + } + } + + pub fn combination_sum4(nums: Vec, target: i32) -> i32 { + Self::helper(&nums, target, &mut HashMap::new()) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_377() { + assert_eq!(Solution::combination_sum4(vec![1,2,3], 4), 7); + assert_eq!(Solution::combination_sum4(vec![9], 3), 0); + } +} diff --git a/src/problem/p0378_kth_smallest_element_in_a_sorted_matrix.rs b/src/problem/p0378_kth_smallest_element_in_a_sorted_matrix.rs new file mode 100644 index 00000000..1ddccbc4 --- /dev/null +++ b/src/problem/p0378_kth_smallest_element_in_a_sorted_matrix.rs @@ -0,0 +1,82 @@ +/** + * [378] Kth Smallest Element in a Sorted Matrix + * + * Given an n x n matrix where each of the rows and columns are sorted in ascending order, return the k^th smallest element in the matrix. + * Note that it is the k^th smallest element in the sorted order, not the k^th distinct element. + * + * Example 1: + * + * Input: matrix = [[1,5,9],[10,11,13],[12,13,15]], k = 8 + * Output: 13 + * Explanation: The elements in the matrix are [1,5,9,10,11,12,13,13,15], and the 8^th smallest number is 13 + * + * Example 2: + * + * Input: matrix = [[-5]], k = 1 + * Output: -5 + * + * + * Constraints: + * + * n == matrix.length + * n == matrix[i].length + * 1 <= n <= 300 + * -10^9 <= matrix[i][j] <= -10^9 + * All the rows and columns of matrix are guaranteed to be sorted in non-degreasing order. + * 1 <= k <= n^2 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/kth-smallest-element-in-a-sorted-matrix/ +// discuss: https://leetcode.com/problems/kth-smallest-element-in-a-sorted-matrix/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn kth_smallest(matrix: Vec>, k: i32) -> i32 { + let mut positions = vec![0 as usize; matrix.len()]; + let n = matrix.len(); + let mut this_min = 0i32; + for i in 0..k { + let mut this_min_row = 0usize; + this_min = 1000000000; + for (j, row) in matrix.iter().enumerate() { + if positions[j] < n && row[positions[j]] < this_min { + this_min = row[positions[j]]; + this_min_row = j; + } + } + positions[this_min_row] += 1; + } + this_min + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_378() { + assert_eq!( + Solution::kth_smallest(vec![ + vec![1,5,9], + vec![10,11,13], + vec![12,13,15], + ], 8), + 13 + ); + + assert_eq!( + Solution::kth_smallest(vec![ + vec![1,3,5], + vec![6,7,12], + vec![11,14,14], + ], 3), + 5 + ); + } +} diff --git a/src/problem/p0380_insert_delete_getrandom_o1.rs b/src/problem/p0380_insert_delete_getrandom_o1.rs new file mode 100644 index 00000000..d01b33c2 --- /dev/null +++ b/src/problem/p0380_insert_delete_getrandom_o1.rs @@ -0,0 +1,115 @@ +/** + * [380] Insert Delete GetRandom O(1) + * + * Implement the RandomizedSet class: + * + * RandomizedSet() Initializes the RandomizedSet object. + * bool insert(int val) Inserts an item val into the set if not present. Returns true if the item was not present, false otherwise. + * bool remove(int val) Removes an item val from the set if present. Returns true if the item was present, false otherwise. + * int getRandom() Returns a random element from the current set of elements (it's guaranteed that at least one element exists when this method is called). Each element must have the same probability of being returned. + * + * You must implement the functions of the class such that each function works in average O(1) time complexity. + * + * Example 1: + * + * Input + * ["RandomizedSet", "insert", "remove", "insert", "getRandom", "remove", "insert", "getRandom"] + * [[], [1], [2], [2], [], [1], [2], []] + * Output + * [null, true, false, true, 2, true, false, 2] + * Explanation + * RandomizedSet randomizedSet = new RandomizedSet(); + * randomizedSet.insert(1); // Inserts 1 to the set. Returns true as 1 was inserted successfully. + * randomizedSet.remove(2); // Returns false as 2 does not exist in the set. + * randomizedSet.insert(2); // Inserts 2 to the set, returns true. Set now contains [1,2]. + * randomizedSet.getRandom(); // getRandom() should return either 1 or 2 randomly. + * randomizedSet.remove(1); // Removes 1 from the set, returns true. Set now contains [2]. + * randomizedSet.insert(2); // 2 was already in the set, so return false. + * randomizedSet.getRandom(); // Since 2 is the only number in the set, getRandom() will always return 2. + * + * + * Constraints: + * + * -2^31 <= val <= 2^31 - 1 + * At most 2 * 10^5 calls will be made to insert, remove, and getRandom. + * There will be at least one element in the data structure when getRandom is called. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/insert-delete-getrandom-o1/ +// discuss: https://leetcode.com/problems/insert-delete-getrandom-o1/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +struct RandomizedSet { + val2pos : HashMap, + values : Vec, +} + + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl RandomizedSet { + + /** Initialize your data structure here. */ + fn new() -> Self { + Self{val2pos : HashMap::new(), values: vec![]} + } + + /** Inserts a value to the set. Returns true if the set did not already contain the specified element. */ + fn insert(&mut self, val: i32) -> bool { + if self.val2pos.get(&val).is_none() { + let pos : usize = self.values.len(); + self.val2pos.insert(val, pos); + self.values.push(val); + true + } else { + false + } + + } + + /** Removes a value from the set. Returns true if the set contained the specified element. */ + fn remove(&mut self, val: i32) -> bool { + if let Some(removed_pos) = self.val2pos.remove(&val) { + let last_val : i32 = self.values.pop().unwrap(); + if removed_pos != self.values.len() { + self.val2pos.insert(last_val, removed_pos); + self.values[removed_pos] = last_val; + } + true + } else { + false + } + } + + /** Get a random element from the set. */ + fn get_random(&self) -> i32 { + use rand::Rng; + let mut rng = rand::thread_rng(); + let rand_idx : usize = rng.gen::() % self.values.len(); + self.values[rand_idx] + } +} + +/** + * Your RandomizedSet object will be instantiated and called as such: + * let obj = RandomizedSet::new(); + * let ret_1: bool = obj.insert(val); + * let ret_2: bool = obj.remove(val); + * let ret_3: i32 = obj.get_random(); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_380() { + } +} diff --git a/src/problem/p0381_insert_delete_getrandom_o1_duplicates_allowed.rs b/src/problem/p0381_insert_delete_getrandom_o1_duplicates_allowed.rs new file mode 100644 index 00000000..77260628 --- /dev/null +++ b/src/problem/p0381_insert_delete_getrandom_o1_duplicates_allowed.rs @@ -0,0 +1,161 @@ +/** + * [381] Insert Delete GetRandom O(1) - Duplicates allowed + * + * Implement the RandomizedCollection class: + * + * RandomizedCollection() Initializes the RandomizedCollection object. + * bool insert(int val) Inserts an item val into the multiset if not present. Returns true if the item was not present, false otherwise. + * bool remove(int val) Removes an item val from the multiset if present. Returns true if the item was present, false otherwise. Note that if val has multiple occurrences in the multiset, we only remove one of them. + * int getRandom() Returns a random element from the current multiset of elements (it's guaranteed that at least one element exists when this method is called). The probability of each element being returned is linearly related to the number of same values the multiset contains. + * + * + * Example 1: + * + * Input + * ["RandomizedCollection", "insert", "insert", "insert", "getRandom", "remove", "getRandom"] + * [[], [1], [1], [2], [], [1], []] + * Output + * [null, true, false, true, 2, true, 1] + * Explanation + * RandomizedCollection randomizedCollection = new RandomizedCollection(); + * randomizedCollection.insert(1); // return True. Inserts 1 to the collection. Returns true as the collection did not contain 1. + * randomizedCollection.insert(1); // return False. Inserts another 1 to the collection. Returns false as the collection contained 1. Collection now contains [1,1]. + * randomizedCollection.insert(2); // return True. Inserts 2 to the collection, returns true. Collection now contains [1,1,2]. + * randomizedCollection.getRandom(); // getRandom should return 1 with the probability 2/3, and returns 2 with the probability 1/3. + * randomizedCollection.remove(1); // return True. Removes 1 from the collection, returns true. Collection now contains [1,2]. + * randomizedCollection.getRandom(); // getRandom should return 1 and 2 both equally likely. + * + * + * Constraints: + * + * -2^31 <= val <= 2^31 - 1 + * At most 10^5 calls will be made to insert, remove, and getRandom. + * There will be at least one element in the data structure when getRandom is called. + * + * + * Follow up: Could you implement the functions of the class with each function works in average O(1) time? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/insert-delete-getrandom-o1-duplicates-allowed/ +// discuss: https://leetcode.com/problems/insert-delete-getrandom-o1-duplicates-allowed/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +use std::collections::HashSet; + +struct RandomizedCollection { + nums : Vec, + positions : HashMap>, +} + + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl RandomizedCollection { + + /** Initialize your data structure here. */ + fn new() -> Self { + RandomizedCollection{nums : vec![], positions : HashMap::new()} + } + + /** Inserts a value to the collection. Returns true if the collection did not already contain the specified element. */ + fn insert(&mut self, val: i32) -> bool { + let pos : usize = self.nums.len(); + self.nums.push(val); + if self.positions.contains_key(&val) { + self.positions.get_mut(&val).unwrap().insert(pos); + true + } else { + self.positions.insert(val, [pos].iter().cloned().collect()); + false + } + } + + /** Removes a value from the collection. Returns true if the collection contained the specified element. */ + fn remove(&mut self, val: i32) -> bool { + // println!("nums={:?}, pos={:?}", self.nums, self.positions); + if self.positions.contains_key(&val) { + // tentatively remove the last number + let last_num : i32 = self.nums.pop().unwrap(); + let last_num_pos : usize = self.nums.len(); + assert!(self.positions.get_mut(&last_num).unwrap().remove(&last_num_pos)); + + + if val != last_num { + // find any position of val to be removed. + let removed_val_pos : usize = *self.positions[&val].iter().next().unwrap(); + assert!(self.positions.get_mut(&val).unwrap().remove(&removed_val_pos)); + + if self.positions[&val].len() == 0 { self.positions.remove(&val); } + + // copy the last number to the removed position. + self.nums[removed_val_pos] = last_num; + self.positions.get_mut(&last_num).unwrap().insert(removed_val_pos); + } else if self.positions[&last_num].len() == 0 { + self.positions.remove(&last_num); + } + true + } else { + false + } + } + + /** Get a random element from the collection. */ + + fn get_random(&self) -> i32 { + use rand::Rng; + let mut rng = rand::thread_rng(); + let pos : usize = rng.gen::() % self.nums.len(); + self.nums[pos] + } +} + +/** + * Your RandomizedCollection object will be instantiated and called as such: + * let obj = RandomizedCollection::new(); + * let ret_1: bool = obj.insert(val); + * let ret_2: bool = obj.remove(val); + * let ret_3: i32 = obj.get_random(); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + fn help(test_label : String, ops : &Vec, parameters : &Vec>) { + let mut rc : RandomizedCollection = RandomizedCollection::new(); + for (i, op) in ops.iter().enumerate() { + if op.eq("insert") { + rc.insert(parameters[i][0]); + } else if op.eq("remove") { + rc.remove(parameters[i][0]); + } else if op.eq("getRandom") { + rc.get_random(); + } + } + } + + #[test] + fn test_381() { + // let ops1 : Vec = vec_string!["RandomizedCollection","insert","insert","insert","getRandom","remove","getRandom"]; + // let params1 : Vec> = vec![vec![],vec![1],vec![1],vec![2],vec![],vec![1],vec![]]; + // help("test1".to_owned(), &ops1, ¶ms1); + + // let ops2 : Vec = vec_string!["RandomizedCollection","insert","remove","insert","remove","getRandom","getRandom","getRandom","getRandom","getRandom","getRandom","getRandom","getRandom","getRandom","getRandom"]; + // let params2 : Vec> = vec![vec![],vec![0],vec![0],vec![-1],vec![0],vec![],vec![],vec![],vec![],vec![],vec![],vec![],vec![],vec![],vec![]]; + // help("test2".to_owned(), &ops2, ¶ms2); + + + let ops3 : Vec = vec_string!["RandomizedCollection","insert","insert","insert","getRandom","remove","getRandom"]; + + + + + let params3 : Vec> = vec![vec![],vec![1],vec![1],vec![2],vec![],vec![1],vec![]]; + help("test3".to_owned(), &ops3, ¶ms3); + } +} diff --git a/src/problem/p0382_linked_list_random_node.rs b/src/problem/p0382_linked_list_random_node.rs new file mode 100644 index 00000000..c13b0b29 --- /dev/null +++ b/src/problem/p0382_linked_list_random_node.rs @@ -0,0 +1,111 @@ +/** + * [382] Linked List Random Node + * + * Given a singly linked list, return a random node's value from the linked list. Each node must have the same probability of being chosen. + * + * Example 1: + * + * Input + * ["Solution", "getRandom", "getRandom", "getRandom", "getRandom", "getRandom"] + * [[[1, 2, 3]], [], [], [], [], []] + * Output + * [null, 1, 3, 2, 2, 3] + * Explanation + * Solution solution = new Solution([1, 2, 3]); + * solution.getRandom(); // return 1 + * solution.getRandom(); // return 3 + * solution.getRandom(); // return 2 + * solution.getRandom(); // return 2 + * solution.getRandom(); // return 3 + * // getRandom() should return either 1, 2, or 3 randomly. Each element should have equal probability of returning. + * + * + * Constraints: + * + * The number of nodes in the linked list will be in the range [1, 10^4]. + * -10^4 <= Node.val <= 10^4 + * At most 10^4 calls will be made to getRandom. + * + * + * Follow up: + * + * What if the linked list is extremely large and its length is unknown to you? + * Could you solve this efficiently without using extra space? + * + */ +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/linked-list-random-node/ +// discuss: https://leetcode.com/problems/linked-list-random-node/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +struct Solution { + head : Option> +} + + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl Solution { + + /** @param head The linked list's head. + Note that the head is guaranteed to be not null, so it contains at least one node. */ + fn new(head: Option>) -> Self { + Self{head: head} + } + + /** Returns a random node's value. */ + fn get_random(&self) -> i32 { + use rand::Rng; + let mut rng = rand::thread_rng(); + + let mut cur : &Option> = &self.head; + let mut count : usize = 0; + let mut target : i32 = 0; + while cur.is_some() { + count += 1; + if rng.gen_range(0.0, 1.0) < 1.0 / (count as f64) { + target = cur.as_ref().unwrap().val; + } + + cur = &cur.as_ref().unwrap().next; + } + target + } +} + +/** + * Your Solution object will be instantiated and called as such: + * let obj = Solution::new(head); + * let ret_1: i32 = obj.get_random(); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_382() { + } +} diff --git a/src/problem/p0384_shuffle_an_array.rs b/src/problem/p0384_shuffle_an_array.rs new file mode 100644 index 00000000..53765152 --- /dev/null +++ b/src/problem/p0384_shuffle_an_array.rs @@ -0,0 +1,90 @@ +/** + * [384] Shuffle an Array + * + * Given an integer array nums, design an algorithm to randomly shuffle the array. + * Implement the Solution class: + * + * Solution(int[] nums) Initializes the object with the integer array nums. + * int[] reset() Resets the array to its original configuration and returns it. + * int[] shuffle() Returns a random shuffling of the array. + * + * + * Example 1: + * + * Input + * ["Solution", "shuffle", "reset", "shuffle"] + * [[[1, 2, 3]], [], [], []] + * Output + * [null, [3, 1, 2], [1, 2, 3], [1, 3, 2]] + * Explanation + * Solution solution = new Solution([1, 2, 3]); + * solution.shuffle(); // Shuffle the array [1,2,3] and return its result. Any permutation of [1,2,3] must be equally likely to be returned. Example: return [3, 1, 2] + * solution.reset(); // Resets the array back to its original configuration [1,2,3]. Return [1, 2, 3] + * solution.shuffle(); // Returns the random shuffling of array [1,2,3]. Example: return [1, 3, 2] + * + * + * Constraints: + * + * 1 <= nums.length <= 200 + * -10^6 <= nums[i] <= 10^6 + * All the elements of nums are unique. + * At most 5 * 10^4 calls will be made to reset and shuffle. + * + */ + +// problem: https://leetcode.com/problems/shuffle-an-array/ +// discuss: https://leetcode.com/problems/shuffle-an-array/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +struct Solution { + origin : Vec, +} + + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl Solution { + + fn new(nums: Vec) -> Self { + Self{origin : nums} + } + + /** Resets the array to its original configuration and return it. */ + fn reset(&self) -> Vec { + self.origin.clone() + } + + /** Returns a random shuffling of the array. */ + fn shuffle(&self) -> Vec { + let mut shuffled : Vec = self.origin.clone(); + use rand::Rng; + let mut rng = rand::thread_rng(); + + for i in (1..(shuffled.len())).rev() { + let r : usize = rng.gen::() % (i+1); + shuffled.swap(i, r); + } + shuffled + } +} + +/** + * Your Solution object will be instantiated and called as such: + * let obj = Solution::new(nums); + * let ret_1: Vec = obj.reset(); + * let ret_2: Vec = obj.shuffle(); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_384() { + } +} diff --git a/src/problem/p0385_mini_parser.rs b/src/problem/p0385_mini_parser.rs new file mode 100644 index 00000000..8234f7ad --- /dev/null +++ b/src/problem/p0385_mini_parser.rs @@ -0,0 +1,98 @@ +/** + * [385] Mini Parser + * + * Given a string s represents the serialization of a nested list, implement a parser to deserialize it and return the deserialized NestedInteger. + * Each element is either an integer or a list whose elements may also be integers or other lists. + * + * Example 1: + * + * Input: s = "324" + * Output: 324 + * Explanation: You should return a NestedInteger object which contains a single integer 324. + * + * Example 2: + * + * Input: s = "[123,[456,[789]]]" + * Output: [123,[456,[789]]] + * Explanation: Return a NestedInteger object containing a nested list with 2 elements: + * 1. An integer containing value 123. + * 2. A nested list containing two elements: + * i. An integer containing value 456. + * ii. A nested list with one element: + * a. An integer containing value 789 + * + * + * Constraints: + * + * 1 <= s.length <= 5 * 10^4 + * s consists of digits, square brackets "[]", negative sign '-', and commas ','. + * s is the serialization of valid NestedInteger. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/mini-parser/ +// discuss: https://leetcode.com/problems/mini-parser/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +#[derive(Debug, PartialEq, Eq)] +pub enum NestedInteger { + Int(i32), + List(Vec) +} +impl Solution { + pub fn deserialize(s: String) -> NestedInteger { + // println!("s={}", s); + let mut chars : Vec = s.chars().collect(); + if chars[0] == '[' { + assert_eq!(*chars.last().unwrap(), ']'); + // exclude the first and list [] + chars.pop(); + chars.drain(0..1); + + let mut l : Vec = vec![]; + // while let Some(comma_pos) = chars.iter().position(|&c|{c==','}) { + loop { + let mut in_bracket_count : usize = 0; + let mut comma_pos : Option = None; + for (i, &c) in chars.iter().enumerate() { + if c == '[' { + in_bracket_count+=1; + } else if c == ']' { + in_bracket_count-=1; + } else if c == ',' && in_bracket_count == 0 { + comma_pos = Some(i); + break; + } + } + if let Some(comma_pos) = comma_pos { + let mut sub_str : Vec = chars.drain(..comma_pos+1).collect(); + sub_str.pop(); // pop the comma + l.push(Solution::deserialize(sub_str.into_iter().collect())); + } else { + break; + } + } + if chars.len() > 0 { + l.push(Solution::deserialize(chars.into_iter().collect())); + } + NestedInteger::List(l) + } else { + NestedInteger::Int(s.parse::().unwrap()) + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_385() { + // println!("{:?}", Solution::deserialize("[123,[456,[789]]]".to_owned())); + println!("{:?}", Solution::deserialize("[123,456,[788,799,833],[[]],10,[]]".to_owned())); + } +} diff --git a/src/problem/p0386_lexicographical_numbers.rs b/src/problem/p0386_lexicographical_numbers.rs new file mode 100644 index 00000000..7888d721 --- /dev/null +++ b/src/problem/p0386_lexicographical_numbers.rs @@ -0,0 +1,78 @@ +/** + * [386] Lexicographical Numbers + * + * Given an integer n, return all the numbers in the range [1, n] sorted in lexicographical order. + * You must write an algorithm that runs in O(n) time and uses O(1) extra space. + * + * Example 1: + * Input: n = 13 + * Output: [1,10,11,12,13,2,3,4,5,6,7,8,9] + * Example 2: + * Input: n = 2 + * Output: [1,2] + * + * Constraints: + * + * 1 <= n <= 5 * 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/lexicographical-numbers/ +// discuss: https://leetcode.com/problems/lexicographical-numbers/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn helper(result : &mut Vec, tmp : &mut Vec, limit : i32) -> bool { + let mut num : i32 = 0; + for &digit in tmp.iter() { + num = 10 * num + digit; + } + + if num <= limit { + if num != 0 { result.push(num); } + if result.len() == limit as usize { + true + } else { + let mut digits : Vec = (0..=9).collect(); + if tmp.len() == 0 { + digits = (1..=9).collect(); + } + + for &digit in digits.iter() { + tmp.push(digit); + if Self::helper(result, tmp, limit) { + return true; + } + tmp.pop(); + } + false + } + } else { + false + } + + + } + + pub fn lexical_order(n: i32) -> Vec { + let mut result : Vec = vec![]; + let mut tmp : Vec = vec![]; + Self::helper(&mut result, &mut tmp, n); + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_386() { + assert_eq!(Solution::lexical_order(13),vec![1,10,11,12,13,2,3,4,5,6,7,8,9]); + assert_eq!(Solution::lexical_order(2),vec![1,2]); + } +} diff --git a/src/problem/p0388_longest_absolute_file_path.rs b/src/problem/p0388_longest_absolute_file_path.rs new file mode 100644 index 00000000..3486c2b7 --- /dev/null +++ b/src/problem/p0388_longest_absolute_file_path.rs @@ -0,0 +1,122 @@ +/** + * [388] Longest Absolute File Path + * + * Suppose we have a file system that stores both files and directories. An example of one system is represented in the following picture: + * + * Here, we have dir as the only directory in the root. dir contains two subdirectories, subdir1 and subdir2. subdir1 contains a file file1.ext and subdirectory subsubdir1. subdir2 contains a subdirectory subsubdir2, which contains a file file2.ext. + * In text form, it looks like this (with ⟶ representing the tab character): + * + * dir + * ⟶ subdir1 + * ⟶ ⟶ file1.ext + * ⟶ ⟶ subsubdir1 + * ⟶ subdir2 + * ⟶ ⟶ subsubdir2 + * ⟶ ⟶ ⟶ file2.ext + * + * If we were to write this representation in code, it will look like this: "dir\n\tsubdir1\n\t\tfile1.ext\n\t\tsubsubdir1\n\tsubdir2\n\t\tsubsubdir2\n\t\t\tfile2.ext". Note that the '\n' and '\t' are the new-line and tab characters. + * Every file and directory has a unique absolute path in the file system, which is the order of directories that must be opened to reach the file/directory itself, all concatenated by '/'s. Using the above example, the absolute path to file2.ext is "dir/subdir2/subsubdir2/file2.ext". Each directory name consists of letters, digits, and/or spaces. Each file name is of the form name.extension, where name and extension consist of letters, digits, and/or spaces. + * Given a string input representing the file system in the explained format, return the length of the longest absolute path to a file in the abstracted file system. If there is no file in the system, return 0. + * + * Example 1: + * + * Input: input = "dir\n\tsubdir1\n\tsubdir2\n\t\tfile.ext" + * Output: 20 + * Explanation: We have only one file, and the absolute path is "dir/subdir2/file.ext" of length 20. + * + * Example 2: + * + * Input: input = "dir\n\tsubdir1\n\t\tfile1.ext\n\t\tsubsubdir1\n\tsubdir2\n\t\tsubsubdir2\n\t\t\tfile2.ext" + * Output: 32 + * Explanation: We have two files: + * "dir/subdir1/file1.ext" of length 21 + * "dir/subdir2/subsubdir2/file2.ext" of length 32. + * We return 32 since it is the longest absolute path to a file. + * + * Example 3: + * + * Input: input = "a" + * Output: 0 + * Explanation: We do not have any files, just a single directory named "a". + * + * Example 4: + * + * Input: input = "file1.txt\nfile2.txt\nlongfile.txt" + * Output: 12 + * Explanation: There are 3 files at the root directory. + * Since the absolute path for anything at the root directory is just the name itself, the answer is "longfile.txt" with length 12. + * + * + * Constraints: + * + * 1 <= input.length <= 10^4 + * input may contain lowercase or uppercase English letters, a new line character '\n', a tab character '\t', a dot '.', a space ' ', and digits. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/longest-absolute-file-path/ +// discuss: https://leetcode.com/problems/longest-absolute-file-path/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn length_longest_path(input: String) -> i32 { + let mut input : Vec = input.chars().collect(); + let mut lines : Vec<(usize, Vec)> = vec![]; + while let Some(new_line_pos) = input.iter().position(|&c|{c == '\n'}) { + let mut line : Vec = input.drain(..new_line_pos+1).collect(); + // println!("input={:?}", input); + line.pop(); // remove the trailing \n + let mut prefix_tab_count : usize = 0; + if let Some(tab_pos) = line.iter().rposition(|&c|{c == '\t'}) { + prefix_tab_count = tab_pos + 1; + } + + line.drain(..prefix_tab_count); + lines.push((prefix_tab_count, line)); + } + + let mut prefix_tab_count : usize = 0; + if let Some(tab_pos) = input.iter().rposition(|&c|{c == '\t'}) { + prefix_tab_count = tab_pos + 1; + } + + input.drain(..prefix_tab_count); + lines.push((prefix_tab_count, input.into_iter().collect())); + + // println!("lines={:?}", lines); + let mut stack : Vec> = vec![]; + let mut max_len : usize = 0; + for (tab_count, name) in lines.into_iter() { + while stack.len() != tab_count { + stack.pop().unwrap(); + } + if name.iter().find(|&&c|{c=='.'}).is_some() { + let path_len : usize = stack.iter().map(|n|{n.len() + 1}).sum::() + name.len(); + max_len = max_len.max(path_len); + } else { + stack.push(name); + } + } + max_len as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_388() { + assert_eq!(Solution::length_longest_path("file1.txt\nfile2.txt\nlongfile.txt".to_owned()), 12); + + assert_eq!(Solution::length_longest_path("a".to_owned()), 0); + + assert_eq!(Solution::length_longest_path("dir\n\tsubdir1\n\tsubdir2\n\t\tfile.ext".to_owned()), 20); + + assert_eq!(Solution::length_longest_path("dir\n\tsubdir1\n\t\tfile1.ext\n\t\tsubsubdir1\n\tsubdir2\n\t\tsubsubdir2\n\t\t\tfile2.ext".to_owned()), 32); + } +} diff --git a/src/problem/p0389_find_the_difference.rs b/src/problem/p0389_find_the_difference.rs new file mode 100644 index 00000000..a2a8536c --- /dev/null +++ b/src/problem/p0389_find_the_difference.rs @@ -0,0 +1,60 @@ +/** + * [389] Find the Difference + * + * You are given two strings s and t. + * String t is generated by random shuffling string s and then add one more letter at a random position. + * Return the letter that was added to t. + * + * Example 1: + * + * Input: s = "abcd", t = "abcde" + * Output: "e" + * Explanation: 'e' is the letter that was added. + * + * Example 2: + * + * Input: s = "", t = "y" + * Output: "y" + * + * Example 3: + * + * Input: s = "a", t = "aa" + * Output: "a" + * + * Example 4: + * + * Input: s = "ae", t = "aea" + * Output: "a" + * + * + * Constraints: + * + * 0 <= s.length <= 1000 + * t.length == s.length + 1 + * s and t consist of lower-case English letters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/find-the-difference/ +// discuss: https://leetcode.com/problems/find-the-difference/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_the_difference(s: String, t: String) -> char { + let l = s.chars().fold(0u8, |acc, c|{acc ^ (c as u8)}); + t.chars().fold(l, |acc, c|{acc ^ (c as u8)}) as char + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_389() { + } +} diff --git a/src/problem/p0390_elimination_game.rs b/src/problem/p0390_elimination_game.rs new file mode 100644 index 00000000..ee5abea3 --- /dev/null +++ b/src/problem/p0390_elimination_game.rs @@ -0,0 +1,67 @@ +/** + * [390] Elimination Game + * + * You have a list arr of all integers in the range [1, n] sorted in a strictly increasing order. Apply the following algorithm on arr: + * + * Starting from left to right, remove the first number and every other number afterward until you reach the end of the list. + * Repeat the previous step again, but this time from right to left, remove the rightmost number and every other number from the remaining numbers. + * Keep repeating the steps again, alternating left to right and right to left, until a single number remains. + * + * Given the integer n, return the last number that remains in arr. + * + * Example 1: + * + * Input: n = 9 + * Output: 6 + * Explanation: + * arr = [1, 2, 3, 4, 5, 6, 7, 8, 9] + * arr = [2, 4, 6, 8] + * arr = [2, 6] + * arr = [6] + * + * Example 2: + * + * Input: n = 1 + * Output: 1 + * + * + * Constraints: + * + * 1 <= n <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/elimination-game/ +// discuss: https://leetcode.com/problems/elimination-game/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn last_remaining(mut n: i32) -> i32 { + let mut left = true; + let mut gap : i32 = 1; // gap of remaining number + let mut head : i32 = 1; + while n > 1 { + if left || n % 2 == 1 { + // head will be eliminated, update the head wit the second. + head += gap; + } + gap *= 2; + n /= 2; + left = !left; + } + head + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_390() { + } +} diff --git a/src/problem/p0391_perfect_rectangle.rs b/src/problem/p0391_perfect_rectangle.rs new file mode 100644 index 00000000..cbc303b0 --- /dev/null +++ b/src/problem/p0391_perfect_rectangle.rs @@ -0,0 +1,147 @@ +/** + * [391] Perfect Rectangle + * + * Given an array rectangles where rectangles[i] = [xi, yi, ai, bi] represents an axis-aligned rectangle. The bottom-left point of the rectangle is (xi, yi) and the top-right point of it is (ai, bi). + * Return true if all the rectangles together form an exact cover of a rectangular region. + * + * Example 1: + * + * Input: rectangles = [[1,1,3,3],[3,1,4,2],[3,2,4,4],[1,3,2,4],[2,3,3,4]] + * Output: true + * Explanation: All 5 rectangles together form an exact cover of a rectangular region. + * + * Example 2: + * + * Input: rectangles = [[1,1,2,3],[1,3,2,4],[3,1,4,2],[3,2,4,4]] + * Output: false + * Explanation: Because there is a gap between the two rectangular regions. + * + * Example 3: + * + * Input: rectangles = [[1,1,3,3],[3,1,4,2],[1,3,2,4],[3,2,4,4]] + * Output: false + * Explanation: Because there is a gap in the top center. + * + * Example 4: + * + * Input: rectangles = [[1,1,3,3],[3,1,4,2],[1,3,2,4],[2,2,4,4]] + * Output: false + * Explanation: Because two of the rectangles overlap with each other. + * + * + * Constraints: + * + * 1 <= rectangles.length <= 2 * 10^4 + * rectangles[i].length == 4 + * -10^5 <= xi, yi, ai, bi <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/perfect-rectangle/ +// discuss: https://leetcode.com/problems/perfect-rectangle/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +const TOP_LEFT : usize = 0b1000; +const TOP_RIGHT : usize = 0b0100; +const BOTTOM_LEFT : usize = 0b0010; +const BOTTOM_RIGHT : usize = 0b0001; + +use std::collections::HashMap; +use std::collections::HashSet; +impl Solution { + pub fn is_rectangle_cover(rectangles: Vec>) -> bool { + let mut min_x : i32 = 10000; + let mut min_y : i32 = 10000; + let mut max_x : i32 = -10000; + let mut max_y : i32 = -10000; + + let mut points : HashMap<(i32,i32), usize> = HashMap::new(); + for rect in rectangles { + let this_bottom_right = points.entry((rect[2], rect[1])).or_insert(0usize); + if *this_bottom_right & BOTTOM_RIGHT == 0 { + *this_bottom_right |= BOTTOM_RIGHT; + } else { + return false; + } + + let this_bottom_left = points.entry((rect[0], rect[1])).or_insert(0usize); + if *this_bottom_left & BOTTOM_LEFT == 0 { + *this_bottom_left |= BOTTOM_LEFT; + } else { + return false; + } + + let this_top_left = points.entry((rect[0], rect[3])).or_insert(0usize); + if *this_top_left & TOP_LEFT == 0 { + *this_top_left |= TOP_LEFT; + } else { + return false; + } + + let this_top_right = points.entry((rect[2], rect[3])).or_insert(0usize); + if *this_top_right & TOP_RIGHT == 0 { + *this_top_right |= TOP_RIGHT; + } else { + return false; + } + + min_x = std::cmp::min(min_x, rect[0]); + min_x = std::cmp::min(min_x, rect[2]); + max_x = std::cmp::max(max_x, rect[0]); + max_x = std::cmp::max(max_x, rect[2]); + + min_y = std::cmp::min(min_y, rect[1]); + min_y = std::cmp::min(min_y, rect[3]); + max_y = std::cmp::max(max_y, rect[1]); + max_y = std::cmp::max(max_y, rect[3]); + } + + println!("points={:?}", points); + + let mut t_patterns : Vec = vec![false;1<<4]; + t_patterns[BOTTOM_LEFT | BOTTOM_RIGHT] = true; + t_patterns[TOP_LEFT | TOP_RIGHT] = true; + t_patterns[TOP_RIGHT | BOTTOM_RIGHT] = true; + t_patterns[TOP_LEFT | BOTTOM_LEFT] = true; + + let mut x_patterns : Vec = vec![false;1<<4]; + x_patterns[BOTTOM_LEFT | BOTTOM_RIGHT | TOP_LEFT | TOP_RIGHT] = true; + + let mut needed_corners : HashSet = [BOTTOM_LEFT, BOTTOM_RIGHT, TOP_LEFT, TOP_RIGHT].iter().cloned().collect(); + for (&ptr, &pattern) in points.iter() { + if min_x < ptr.0 && ptr.0 < max_x || min_y < ptr.1 && ptr.1 < max_y { + // interior point, either be t-formed or x-formed. + if !t_patterns[pattern] && !x_patterns[pattern] { + // println!("illegal interior point {:?} and pattern {}", ptr, pattern); + return false; + } + } else { + // corner point, check there exists at least 4 corners, each with different types. + if !needed_corners.remove(&pattern) { + // println!("illegal corner point {:?} and pattern {}", ptr, pattern); + return false; + } + } + } + true + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_391() { + assert!(Solution::is_rectangle_cover(vec![vec![1,1,3,3],vec![3,1,4,2],vec![3,2,4,4],vec![1,3,2,4],vec![2,3,3,4]])); + + assert!(!Solution::is_rectangle_cover(vec![vec![1,1,2,3],vec![1,3,2,4],vec![3,1,4,2],vec![3,2,4,4]])); + + assert!(!Solution::is_rectangle_cover(vec![vec![1,1,3,3],vec![3,1,4,2],vec![1,3,2,4],vec![3,2,4,4]])); + + assert!(!Solution::is_rectangle_cover(vec![vec![1,1,3,3],vec![3,1,4,2],vec![1,3,2,4],vec![2,2,4,4]])); + } +} diff --git a/src/problem/p0393_utf_8_validation.rs b/src/problem/p0393_utf_8_validation.rs new file mode 100644 index 00000000..59d564d8 --- /dev/null +++ b/src/problem/p0393_utf_8_validation.rs @@ -0,0 +1,102 @@ +/** + * [393] UTF-8 Validation + * + * Given an integer array data representing the data, return whether it is a valid UTF-8 encoding. + * A character in UTF8 can be from 1 to 4 bytes long, subjected to the following rules: + *
    + * For a 1-byte character, the first bit is a 0, followed by its Unicode code. + * For an n-bytes character, the first n bits are all one's, the n + 1 bit is 0, followed by n - 1 bytes with the most significant 2 bits being 10. + *
+ * This is how the UTF-8 encoding would work: + * + * Char. number range | UTF-8 octet sequence + * (hexadecimal) | (binary) + * --------------------+--------------------------------------------- + * 0000 0000-0000 007F | 0xxxxxxx + * 0000 0080-0000 07FF | 110xxxxx 10xxxxxx + * 0000 0800-0000 FFFF | 1110xxxx 10xxxxxx 10xxxxxx + * 0001 0000-0010 FFFF | 11110xxx 10xxxxxx 10xxxxxx 10xxxxxx + * + * Note: The input is an array of integers. Only the least significant 8 bits of each integer is used to store the data. This means each integer represents only 1 byte of data. + * + * Example 1: + * + * Input: data = [197,130,1] + * Output: true + * Explanation: data represents the octet sequence: 11000101 10000010 00000001. + * It is a valid utf-8 encoding for a 2-bytes character followed by a 1-byte character. + * + * Example 2: + * + * Input: data = [235,140,4] + * Output: false + * Explanation: data represented the octet sequence: 11101011 10001100 00000100. + * The first 3 bits are all one's and the 4th bit is 0 means it is a 3-bytes character. + * The next byte is a continuation byte which starts with 10 and that's correct. + * But the second continuation byte does not start with 10, so it is invalid. + * + * + * Constraints: + * + * 1 <= data.length <= 2 * 10^4 + * 0 <= data[i] <= 255 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/utf-8-validation/ +// discuss: https://leetcode.com/problems/utf-8-validation/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn leading1_count(n : u8) -> usize { + let mut count : usize = 0; + for i in (0..8).rev() { + if n & (1 << i) != 0 { + count+=1; + } else { + break; + } + } + count + } + pub fn valid_utf8(data: Vec) -> bool { + let mut data : Vec = data.into_iter().rev().collect(); + while let Some(head) = data.pop() { + let mut head : u8 = (head & 0xFF) as u8; + let leading1_count : usize = Self::leading1_count(head) as usize; + // println!("head={}, leading1_count={}", head, leading1_count); + if leading1_count == 0 { + // valid, do nothing + } else if leading1_count == 1 || leading1_count > 4 { + return false; + } else if data.len() < leading1_count - 1 { + return false; + } else { + for i in 0..(leading1_count-1) { + head = (data.pop().unwrap() & 0xFF) as u8; + // println!("head={:0b}", head); + let digit7_one = (head & (1 << 7)) != 0; + let digit6_zero = (head & (1 << 6)) == 0; + if !(digit7_one && digit6_zero) {return false} + } + } + } + true + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_393() { + assert!(Solution::valid_utf8(vec![197,130,1])); + assert!(!Solution::valid_utf8(vec![235,140,4])); + assert!(!Solution::valid_utf8(vec![250,145,145,145,145])); + } +} diff --git a/src/problem/p0394_decode_string.rs b/src/problem/p0394_decode_string.rs new file mode 100644 index 00000000..a1d0b394 --- /dev/null +++ b/src/problem/p0394_decode_string.rs @@ -0,0 +1,97 @@ +use futures::io::repeat; + +/** + * [394] Decode String + * + * Given an encoded string, return its decoded string. + * The encoding rule is: k[encoded_string], where the encoded_string inside the square brackets is being repeated exactly k times. Note that k is guaranteed to be a positive integer. + * You may assume that the input string is always valid; No extra white spaces, square brackets are well-formed, etc. + * Furthermore, you may assume that the original data does not contain any digits and that digits are only for those repeat numbers, k. For example, there won't be input like 3a or 2[4]. + * + * Example 1: + * Input: s = "3[a]2[bc]" + * Output: "aaabcbc" + * Example 2: + * Input: s = "3[a2[c]]" + * Output: "accaccacc" + * Example 3: + * Input: s = "2[abc]3[cd]ef" + * Output: "abcabccdcdcdef" + * Example 4: + * Input: s = "abc3[cd]xyz" + * Output: "abccdcdcdxyz" + * + * Constraints: + * + * 1 <= s.length <= 30 + * s consists of lowercase English letters, digits, and square brackets '[]'. + * s is guaranteed to be a valid input. + * All the integers in s are in the range [1, 300]. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/decode-string/ +// discuss: https://leetcode.com/problems/decode-string/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn decode_string(s: String) -> String { + let mut stack = vec![]; + let mut result = String::from(""); + for c in s.chars() { + println!("Char = {}", c); + if c.is_ascii_digit() { + stack.push(c.to_string()); + } else if c == ']' { + let mut raw_str = String::from(""); + while let Some(last) = stack.pop() { + // print!("\tStack Pop: {}", last); + if last == "[" { + break; + } + raw_str = last + raw_str.as_str(); + } + + let mut raw_digits = String::from(""); + while let Some(last) = stack.last(){ + if last.chars().nth(0).unwrap().is_ascii_digit() { + raw_digits = last.clone() + raw_digits.as_str(); + stack.pop(); + } else { + break + } + } + let count = raw_digits.parse::().unwrap(); + let repeated = raw_str.repeat(count as usize); + println!("Repeated: {}", repeated); + + if stack.is_empty() { + result = result + repeated.as_str(); + } else { + stack.push(repeated); + } + } else if stack.is_empty() { + result.push(c); + } else { + stack.push(c.to_string()); + } + println!("Stack = {:?}", stack); + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_394() { + assert_eq!(Solution::decode_string("3[a2[c]]".to_string()), "accaccacc"); + + } +} diff --git a/src/problem/p0395_longest_substring_with_at_least_k_repeating_characters.rs b/src/problem/p0395_longest_substring_with_at_least_k_repeating_characters.rs new file mode 100644 index 00000000..90d1c8ad --- /dev/null +++ b/src/problem/p0395_longest_substring_with_at_least_k_repeating_characters.rs @@ -0,0 +1,78 @@ +/** + * [395] Longest Substring with At Least K Repeating Characters + * + * Given a string s and an integer k, return the length of the longest substring of s such that the frequency of each character in this substring is greater than or equal to k. + * + * Example 1: + * + * Input: s = "aaabb", k = 3 + * Output: 3 + * Explanation: The longest substring is "aaa", as 'a' is repeated 3 times. + * + * Example 2: + * + * Input: s = "ababbc", k = 2 + * Output: 5 + * Explanation: The longest substring is "ababb", as 'a' is repeated 2 times and 'b' is repeated 3 times. + * + * + * Constraints: + * + * 1 <= s.length <= 10^4 + * s consists of only lowercase English letters. + * 1 <= k <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/longest-substring-with-at-least-k-repeating-characters/ +// discuss: https://leetcode.com/problems/longest-substring-with-at-least-k-repeating-characters/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn helper(s : &Vec, mut start : usize, end : usize, k : usize) -> usize { + // println!("start={}, end={}", start, end); + if end <= start {return 0} + let len : usize = end - start; + let mut freq : [usize;26] = [0;26]; + for i in start..end { + let char_pos : usize = ((s[i] as u8) - ('a' as u8)) as usize; + freq[char_pos]+=1; + } + let mut i : usize = start; + let mut next_start : usize = start; + let mut r : usize = 0; + let mut full = true; + while i < end { + let char_pos : usize = ((s[i] as u8) - ('a' as u8)) as usize; + if freq[char_pos] < k { + r = r.max(Self::helper(s, next_start, i, k)); + next_start = i + 1; + full = false; + } + i+=1; + } + if next_start != start { + r = r.max(Self::helper(s, next_start, i, k)); + } + if full {len} else {r} + } + + pub fn longest_substring(s: String, k: i32) -> i32 { + let s : Vec = s.chars().collect(); + Self::helper(&s, 0, s.len(), k as usize) as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_395() { + assert_eq!(Solution::longest_substring("aaabb".to_owned(), 3), 3); + } +} diff --git a/src/problem/p0396_rotate_function.rs b/src/problem/p0396_rotate_function.rs new file mode 100644 index 00000000..bec15bc0 --- /dev/null +++ b/src/problem/p0396_rotate_function.rs @@ -0,0 +1,71 @@ +/** + * [396] Rotate Function + * + * You are given an integer array nums of length n. + * Assume arrk to be an array obtained by rotating nums by k positions clock-wise. We define the rotation function F on nums as follow: + * + * F(k) = 0 * arrk[0] + 1 * arrk[1] + ... + (n - 1) * arrk[n - 1]. + * + * Return the maximum value of F(0), F(1), ..., F(n-1). + * The test cases are generated so that the answer fits in a 32-bit integer. + * + * Example 1: + * + * Input: nums = [4,3,2,6] + * Output: 26 + * Explanation: + * F(0) = (0 * 4) + (1 * 3) + (2 * 2) + (3 * 6) = 0 + 3 + 4 + 18 = 25 + * F(1) = (0 * 6) + (1 * 4) + (2 * 3) + (3 * 2) = 0 + 4 + 6 + 6 = 16 + * F(2) = (0 * 2) + (1 * 6) + (2 * 4) + (3 * 3) = 0 + 6 + 8 + 9 = 23 + * F(3) = (0 * 3) + (1 * 2) + (2 * 6) + (3 * 4) = 0 + 2 + 12 + 12 = 26 + * So the maximum value of F(0), F(1), F(2), F(3) is F(3) = 26. + * + * Example 2: + * + * Input: nums = [1000000007] + * Output: 0 + * + * + * Constraints: + * + * n == nums.length + * 1 <= n <= 10^5 + * -100 <= nums[i] <= 100 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/rotate-function/ +// discuss: https://leetcode.com/problems/rotate-function/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn max_rotate_function(nums: Vec) -> i32 { + let mut base = 0i32; + let mut sum = 0i32; + let n : i32 = nums.len() as i32; + for (i, &num) in nums.iter().enumerate() { + base += (i as i32) * num; + sum += num; + } + let mut r : i32 = 1 << 31; + for num in nums.into_iter().rev() { + r = r.max(base); + base += sum - n * num; + } + r + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_396() { + assert_eq!(Solution::max_rotate_function(vec![4,3,2,6]), 26); + } +} diff --git a/src/problem/p0397_integer_replacement.rs b/src/problem/p0397_integer_replacement.rs new file mode 100644 index 00000000..3c62f811 --- /dev/null +++ b/src/problem/p0397_integer_replacement.rs @@ -0,0 +1,69 @@ +/** + * [397] Integer Replacement + * + * Given a positive integer n, you can apply one of the following operations: + *
    + * If n is even, replace n with n / 2. + * If n is odd, replace n with either n + 1 or n - 1. + *
+ * Return the minimum number of operations needed for n to become 1. + * + * Example 1: + * + * Input: n = 8 + * Output: 3 + * Explanation: 8 -> 4 -> 2 -> 1 + * + * Example 2: + * + * Input: n = 7 + * Output: 4 + * Explanation: 7 -> 8 -> 4 -> 2 -> 1 + * or 7 -> 6 -> 3 -> 2 -> 1 + * + * Example 3: + * + * Input: n = 4 + * Output: 2 + * + * + * Constraints: + * + * 1 <= n <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/integer-replacement/ +// discuss: https://leetcode.com/problems/integer-replacement/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn integer_replacement(mut n: i32) -> i32 { + let mut n = n as i64; + let mut count = 0; + while 1 < n { + if n % 2 == 0 { + n = n / 2; + } else if (n+1) % 4 == 0 && n != 3{ + n += 1; + } else { + n -= 1; + } + count+=1; + } + count + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_397() { + } +} diff --git a/src/problem/p0398_random_pick_index.rs b/src/problem/p0398_random_pick_index.rs new file mode 100644 index 00000000..87b7b045 --- /dev/null +++ b/src/problem/p0398_random_pick_index.rs @@ -0,0 +1,80 @@ +/** + * [398] Random Pick Index + * + * Given an integer array nums with possible duplicates, randomly output the index of a given target number. You can assume that the given target number must exist in the array. + * Implement the Solution class: + * + * Solution(int[] nums) Initializes the object with the array nums. + * int pick(int target) Picks a random index i from nums where nums[i] == target. If there are multiple valid i's, then each index should have an equal probability of returning. + * + * + * Example 1: + * + * Input + * ["Solution", "pick", "pick", "pick"] + * [[[1, 2, 3, 3, 3]], [3], [1], [3]] + * Output + * [null, 4, 0, 2] + * Explanation + * Solution solution = new Solution([1, 2, 3, 3, 3]); + * solution.pick(3); // It should return either index 2, 3, or 4 randomly. Each index should have equal probability of returning. + * solution.pick(1); // It should return 0. Since in the array only nums[0] is equal to 1. + * solution.pick(3); // It should return either index 2, 3, or 4 randomly. Each index should have equal probability of returning. + * + * + * Constraints: + * + * 1 <= nums.length <= 2 * 10^4 + * -2^31 <= nums[i] <= 2^31 - 1 + * target is an integer from nums. + * At most 10^4 calls will be made to pick. + * + */ +// problem: https://leetcode.com/problems/random-pick-index/ +// discuss: https://leetcode.com/problems/random-pick-index/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +struct Solution { + num2positions : HashMap>, +} + + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl Solution { + + fn new(nums: Vec) -> Self { + let mut num2positions : HashMap> = HashMap::new(); + for (i, num) in nums.into_iter().enumerate() { + num2positions.entry(num).or_insert(vec![]).push(i); + } + Self{num2positions : num2positions} + } + + fn pick(&self, target: i32) -> i32 { + use rand::Rng; + let mut rng = rand::thread_rng(); + let rand_pos : usize = rng.gen::() % self.num2positions[&target].len(); + self.num2positions[&target][rand_pos] as i32 + } +} + +/** + * Your Solution object will be instantiated and called as such: + * let obj = Solution::new(nums); + * let ret_1: i32 = obj.pick(target); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_398() { + } +} diff --git a/src/problem/p0399_evaluate_division.rs b/src/problem/p0399_evaluate_division.rs new file mode 100644 index 00000000..9756f0cb --- /dev/null +++ b/src/problem/p0399_evaluate_division.rs @@ -0,0 +1,190 @@ +/** + * [399] Evaluate Division + * + * You are given an array of variable pairs equations and an array of real numbers values, where equations[i] = [Ai, Bi] and values[i] represent the equation Ai / Bi = values[i]. Each Ai or Bi is a string that represents a single variable. + * You are also given some queries, where queries[j] = [Cj, Dj] represents the j^th query where you must find the answer for Cj / Dj = ?. + * Return the answers to all queries. If a single answer cannot be determined, return -1.0. + * Note: The input is always valid. You may assume that evaluating the queries will not result in division by zero and that there is no contradiction. + * + * Example 1: + * + * Input: equations = [["a","b"],["b","c"]], values = [2.0,3.0], queries = [["a","c"],["b","a"],["a","e"],["a","a"],["x","x"]] + * Output: [6.00000,0.50000,-1.00000,1.00000,-1.00000] + * Explanation: + * Given: a / b = 2.0, b / c = 3.0 + * queries are: a / c = ?, b / a = ?, a / e = ?, a / a = ?, x / x = ? + * return: [6.0, 0.5, -1.0, 1.0, -1.0 ] + * + * Example 2: + * + * Input: equations = [["a","b"],["b","c"],["bc","cd"]], values = [1.5,2.5,5.0], queries = [["a","c"],["c","b"],["bc","cd"],["cd","bc"]] + * Output: [3.75000,0.40000,5.00000,0.20000] + * + * Example 3: + * + * Input: equations = [["a","b"]], values = [0.5], queries = [["a","b"],["b","a"],["a","c"],["x","y"]] + * Output: [0.50000,2.00000,-1.00000,-1.00000] + * + * + * Constraints: + * + * 1 <= equations.length <= 20 + * equations[i].length == 2 + * 1 <= Ai.length, Bi.length <= 5 + * values.length == equations.length + * 0.0 < values[i] <= 20.0 + * 1 <= queries.length <= 20 + * queries[i].length == 2 + * 1 <= Cj.length, Dj.length <= 5 + * Ai, Bi, Cj, Dj consist of lower case English letters and digits. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/evaluate-division/ +// discuss: https://leetcode.com/problems/evaluate-division/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; + +impl Solution { + pub fn find_root_with_compression(parents: &mut HashMap, factor_parents: &mut HashMap, target : String) -> Option<(String, f64)> { + if !parents.contains_key(&target) {return None;} + + let mut root : String = target.clone(); + let mut root_times = 1f64; + while root != parents[&root] { + // println!("root={}, parent_factor={}, times={}", root, factor_parents[&root], times); + root_times *= factor_parents[&root]; + root = parents[&root].clone(); + } + + let mut target = target.clone(); + let mut times = root_times; + while target != parents[&target] { + let prev = parents[&target].clone(); + let prev_factor = factor_parents[&target]; + + parents.insert(target.clone(), root.clone()); + factor_parents.insert(target.clone(), times); + + times /= prev_factor; + target = prev; + } + + + Some((root, root_times)) + } + + pub fn calc_equation(equations: Vec>, values: Vec, queries: Vec>) -> Vec { + let mut parents = HashMap::new(); + // the parent is x times than itself. + let mut factor_parents = HashMap::new(); + let mut subset_sizes = HashMap::new(); + + let n = equations.len(); + for i in 0..n { + let e1_root : String; + let e2_root : String; + let e1_times : f64; + let e2_times : f64; + + let e1 = equations[i][0].clone(); + let e2 = equations[i][1].clone(); + if let Some((root, times)) = Self::find_root_with_compression(&mut parents, &mut factor_parents, e1.clone()) { + e1_root = root; + e1_times = times; + } else { + parents.insert(e1.clone(), e1.clone()); + factor_parents.insert(e1.clone(), 1.0); + subset_sizes.insert(e1.clone(), 1usize); + + e1_root = e1.clone(); + e1_times = 1.0; + } + + if let Some((root, times)) = Self::find_root_with_compression(&mut parents, &mut factor_parents, e2.clone()) { + e2_root = root; + e2_times = times; + } else { + parents.insert(e2.clone(), e2.clone()); + factor_parents.insert(e2.clone(), 1.0); + subset_sizes.insert(e2.clone(), 1usize); + e2_root = e2.clone(); + e2_times = 1.0; + } + + let e1_size = *subset_sizes.get(&e1_root).unwrap(); + let e2_size = *subset_sizes.get(&e2_root).unwrap(); + + + if e1_size < e2_size { + parents.insert(e1_root.clone(), e2_root.clone()); + factor_parents.insert(e1_root.clone(), e2_times / e1_times / values[i]); + subset_sizes.insert(e2_root.clone(), e1_size + e2_size); + } else { + parents.insert(e2_root.clone(), e1_root.clone()); + factor_parents.insert(e2_root.clone(), e1_times * values[i] / e2_times); + subset_sizes.insert(e1_root.clone(), e1_size + e2_size); + } + + // println!("e1={}, e2={}, e1_root={}, e2_root={}, e1_times={}, e2_times={}", e1, e2, e1_root, e2_root, e1_times, e2_times); + // println!("parents={:?}, factor_parents={:?}, subset_sizes={:?}", parents, factor_parents, subset_sizes); + // println!(""); + + } + + let mut result = vec![]; + for query in &queries { + let mut q1_root : String; + let mut q2_root : String; + let mut q1_times : f64; + let mut q2_times : f64; + + if let Some((root, times)) = Self::find_root_with_compression(&mut parents, &mut factor_parents, query[0].clone()) { + q1_root = root; + q1_times = times; + } else { + result.push(-1f64); + continue; + } + + if let Some((root, times)) = Self::find_root_with_compression(&mut parents, &mut factor_parents, query[1].clone()) { + q2_root = root; + q2_times = times; + } else { + result.push(-1f64); + continue; + } + // println!("q1={}, q2={}, q1_root={}, q2_root={}, q1_times={}, q2_times={}", query[0], query[1], q1_root, q2_root, q1_times, q2_times); + if q1_root == q2_root { + result.push(q2_times / q1_times); + } else { + result.push(-1f64); + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_399() { + assert_eq!(Solution::calc_equation( + vec![vec!["a".to_owned(),"b".to_owned()],vec!["b".to_owned(),"c".to_owned()]], + vec![2.0,3.0], vec![vec!["a".to_owned(),"c".to_owned()],vec!["b".to_owned(),"a".to_owned()],vec!["a".to_owned(),"e".to_owned()],vec!["a".to_owned(),"a".to_owned()],vec!["x".to_owned(),"x".to_owned()]]), vec![6.00000,0.50000,-1.00000,1.00000,-1.00000]); + + assert_eq!(Solution::calc_equation( + vec![vec!["a".to_owned(),"b".to_owned()],vec!["b".to_owned(),"c".to_owned()],vec!["bc".to_owned(),"cd".to_owned()]], + vec![1.5, 2.5, 5.0], vec![vec!["a".to_owned(),"c".to_owned()],vec!["c".to_owned(),"b".to_owned()],vec!["bc".to_owned(),"cd".to_owned()],vec!["cd".to_owned(),"bc".to_owned()]]), vec![3.75000,0.40000,5.00000,0.20000]); + + assert_eq!(Solution::calc_equation( + vec![vec!["a".to_owned(),"b".to_owned()]], + vec![0.5], vec![vec!["a".to_owned(),"b".to_owned()],vec!["b".to_owned(),"a".to_owned()],vec!["a".to_owned(),"c".to_owned()],vec!["x".to_owned(),"y".to_owned()]]), vec![0.50000,2.00000,-1.00000,-1.00000]); + } +} diff --git a/src/problem/p0400_nth_digit.rs b/src/problem/p0400_nth_digit.rs new file mode 100644 index 00000000..e2a8263d --- /dev/null +++ b/src/problem/p0400_nth_digit.rs @@ -0,0 +1,59 @@ +/** + * [400] Nth Digit + * + * Given an integer n, return the n^th digit of the infinite integer sequence [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, ...]. + * + * Example 1: + * + * Input: n = 3 + * Output: 3 + * + * Example 2: + * + * Input: n = 11 + * Output: 0 + * Explanation: The 11^th digit of the sequence 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, ... is a 0, which is part of the number 10. + * + * + * Constraints: + * + * 1 <= n <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/nth-digit/ +// discuss: https://leetcode.com/problems/nth-digit/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_nth_digit(n: i32) -> i32 { + let mut n : usize = n as usize - 1; + let mut digit_count : usize = 1; + let mut count : usize = 9; + let mut digit_base = 1; + while n >= digit_count * count { + n -= digit_count * count; + digit_count += 1; + digit_base *=10; + count *= 10; + } + let mut num : usize = (digit_base + n / digit_count); + (num.to_string().chars().nth(n%digit_count).unwrap() as u8 - '0' as u8) as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_400() { + // assert_eq!(Solution::find_nth_digit(3), 3); + // assert_eq!(Solution::find_nth_digit(11), 0); + assert_eq!(Solution::find_nth_digit(100), 5); + } +} diff --git a/src/problem/p0403_frog_jump.rs b/src/problem/p0403_frog_jump.rs new file mode 100644 index 00000000..1e312f3a --- /dev/null +++ b/src/problem/p0403_frog_jump.rs @@ -0,0 +1,87 @@ +/** + * [403] Frog Jump + * + * A frog is crossing a river. The river is divided into some number of units, and at each unit, there may or may not exist a stone. The frog can jump on a stone, but it must not jump into the water. + * Given a list of stones' positions (in units) in sorted ascending order, determine if the frog can cross the river by landing on the last stone. Initially, the frog is on the first stone and assumes the first jump must be 1 unit. + * If the frog's last jump was k units, its next jump must be either k - 1, k, or k + 1 units. The frog can only jump in the forward direction. + * + * Example 1: + * + * Input: stones = [0,1,3,5,6,8,12,17] + * Output: true + * Explanation: The frog can jump to the last stone by jumping 1 unit to the 2nd stone, then 2 units to the 3rd stone, then 2 units to the 4th stone, then 3 units to the 6th stone, 4 units to the 7th stone, and 5 units to the 8th stone. + * + * Example 2: + * + * Input: stones = [0,1,2,3,4,8,9,11] + * Output: false + * Explanation: There is no way to jump to the last stone as the gap between the 5th and 6th stone is too large. + * + * + * Constraints: + * + * 2 <= stones.length <= 2000 + * 0 <= stones[i] <= 2^31 - 1 + * stones[0] == 0 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/frog-jump/ +// discuss: https://leetcode.com/problems/frog-jump/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::collections::HashMap; +use std::collections::HashSet; +impl Solution { + pub fn can_cross(stones: Vec) -> bool { + let mut allowable_steps_on_stone : HashMap> = HashMap::new(); + + let last_stone : i32 = *stones.last().unwrap(); + for &stone in stones.iter() { + allowable_steps_on_stone.insert(stone,HashSet::new()); + } + allowable_steps_on_stone.get_mut(&0i32).unwrap().insert(1); + + for &stone in stones.iter() { + let mut stone_added_steps : HashMap> = HashMap::new(); + for &allowable_step in allowable_steps_on_stone[&stone].iter() { + // for i in 0..allowable_steps_on_stone[&stone].len() { + + let reach : i32 = stone + allowable_step; + if reach == last_stone {return true;} + + stone_added_steps.entry(reach).or_insert(HashSet::new()).insert(allowable_step); + stone_added_steps.entry(reach).or_insert(HashSet::new()).insert(allowable_step + 1); + if allowable_step - 1 > 0 { + stone_added_steps.entry(reach).or_insert(HashSet::new()).insert(allowable_step - 1); + } + } + + for (&stone, added_steps) in stone_added_steps.iter() { + if let Some(allowable_steps) = allowable_steps_on_stone.get_mut(&stone) { + for &added_step in added_steps.iter() { + allowable_steps.insert(added_step); + } + } + } + + } + + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_403() { + assert!(Solution::can_cross(vec![0,1,3,5,6,8,12,17])); + assert!(!Solution::can_cross(vec![0,1,2,3,4,8,9,11])); + } +} diff --git a/src/problem/p0407_trapping_rain_water_ii.rs b/src/problem/p0407_trapping_rain_water_ii.rs new file mode 100644 index 00000000..9c898001 --- /dev/null +++ b/src/problem/p0407_trapping_rain_water_ii.rs @@ -0,0 +1,274 @@ +/** + * [407] Trapping Rain Water II + * + * Given an m x n integer matrix heightMap representing the height of each unit cell in a 2D elevation map, return the volume of water it can trap after raining. + * + * Example 1: + * + * Input: heightMap = [[1,4,3,1,3,2],[3,2,1,3,2,4],[2,3,3,2,3,1]] + * Output: 4 + * Explanation: After the rain, water is trapped between the blocks. + * We have two small pounds 1 and 3 units trapped. + * The total volume of water trapped is 4. + * + * Example 2: + * + * Input: heightMap = [[3,3,3,3,3],[3,2,2,2,3],[3,2,1,2,3],[3,2,2,2,3],[3,3,3,3,3]] + * Output: 10 + * + * + * Constraints: + * + * m == heightMap.length + * n == heightMap[i].length + * 1 <= m, n <= 200 + * 0 <= heightMap[i][j] <= 2 * 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/trapping-rain-water-ii/ +// discuss: https://leetcode.com/problems/trapping-rain-water-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use super::p0000_template::VecHeap; + +// use std::cmp::Ordering; +// use std::{collections::HashMap, hash::Hash}; +// #[derive(Debug)] +// pub struct VecHeap{ +// elements: Vec<(K,W,V)>, +// key2idx: HashMap, +// } + +// impl VecHeap{ + +// pub fn new(keys: Vec, weights : Vec, values : Vec) -> VecHeap { +// let mut vh = VecHeap{elements: vec![], key2idx: HashMap::new()}; +// let n = keys.len(); +// for i in 0..keys.len() { +// let idx = vh.elements.len(); +// vh.key2idx.insert(keys[i].clone(), idx); +// vh.elements.push((keys[i].clone(), weights[i].clone(), values[i].clone())); +// } + +// for i in (0..(n/2)).rev() { +// vh.topdown_heapify(i, n); +// } + +// vh +// } + +// pub fn reweight_with_default(&mut self, key: &K, weight: &W, default_value: V) -> bool { +// if let Some((k,w,v)) = self.remove(key) { +// self.insert(k, weight.clone(),v); +// true +// } else { +// self.insert(key.clone(), weight.clone(),default_value); +// false +// } +// } + +// pub fn reweight(&mut self, key: &K, weight: &W) -> bool { +// if let Some((k,w,v)) = self.remove(key) { +// self.insert(k, weight.clone(),v); +// true +// } else { +// false +// } +// } + +// pub fn remove(&mut self, key : &K) -> Option<(K,W,V)> { +// if let Some(&removed_pos) = self.key2idx.get(key) { +// // swap the removed element with the last element. +// self.key2idx.remove(key); +// if removed_pos == self.elements.len() - 1 { +// self.elements.pop() +// } else { +// //swap the removed element wit the last. +// let removed = self.elements[removed_pos].clone(); +// let last_entry = self.elements.pop().unwrap(); +// self.key2idx.insert(last_entry.0.clone(), removed_pos); +// self.elements[removed_pos] = last_entry; + +// // topdown_heapify from the removed pos +// self.topdown_heapify(removed_pos, self.len()); +// Some(removed) +// } + +// } else { +// None +// } +// } + +// pub fn insert(&mut self, key: K, weight: W, value: V) -> bool { +// if self.key2idx.get(&key).is_none() { +// let last_pos = self.elements.len(); +// self.key2idx.insert(key.clone(), last_pos); +// self.elements.push((key, weight, value)); +// self.bottomup_heapify(last_pos); +// true +// } else { +// false +// } + +// } + +// pub fn bottomup_heapify(&mut self, start_pos : usize) { +// if 0 < start_pos { +// let parent_pos = (start_pos + 1) / 2 - 1; +// if self.elements[parent_pos].1.cmp(&self.elements[start_pos].1) == Ordering::Less { +// self.elements.swap(parent_pos, start_pos); +// self.key2idx.insert(self.elements[start_pos].0.clone(), start_pos); +// self.key2idx.insert(self.elements[parent_pos].0.clone(), parent_pos); +// self.bottomup_heapify(parent_pos); +// } +// } +// } + +// pub fn topdown_heapify(&mut self, start_pos: usize, max_len: usize ) { +// let left_pos = 2 * start_pos + 1; +// let right_pos = 2 * (start_pos + 1); + +// let mut large_pos = None; +// let mut large_weight = self.elements[start_pos].1.clone(); +// if left_pos < max_len && large_weight.cmp(&self.elements[left_pos].1) == Ordering::Less { +// large_weight = self.elements[left_pos].1.clone(); +// large_pos = Some(left_pos); +// } + +// if right_pos < max_len && large_weight.cmp(&self.elements[right_pos].1) == Ordering::Less { +// large_weight = self.elements[right_pos].1.clone(); +// large_pos = Some(right_pos); +// } + +// if let Some(large_pos) = large_pos { +// self.elements.swap(start_pos, large_pos); +// self.key2idx.insert(self.elements[start_pos].0.clone(), start_pos); +// self.key2idx.insert(self.elements[large_pos].0.clone(), large_pos); + +// self.topdown_heapify(large_pos, max_len); +// } +// } + +// pub fn max(&self) -> Option<&(K,W,V)> { +// self.elements.get(0) +// } + +// pub fn len(&self) -> usize { +// self.elements.len() +// } + +// } + +impl Solution { + pub fn trap_rain_water(height_map: Vec>) -> i32 { + // the trapped water volume of a unit is determined by the lowest unit among all the max units in each path towards the boundary. + + // Since all such paths from cell[i][j] must include itself, hence lowest_heights[i][j] >= height_map[i][j] + // -1 implies not considered yet. + let row_count : usize = height_map.len(); + let col_count : usize = height_map[0].len(); + + let mut lowest_heights : Vec> = vec![vec![-1;col_count];row_count]; + + // value is useless. + let mut vh : VecHeap<(usize, usize), i32, i32> = VecHeap::new( + vec![], vec![], vec![]); + + // For all boundary cases, since it can directly reach boundary by itself, we can achieve the equality, where lowest_heights[i][j] == height_map[i][j] + + for i in 0..row_count { + vh.insert((i, 0), -height_map[i][0], 0); + lowest_heights[i][0] = height_map[i][0]; + + vh.insert((i, col_count-1), -height_map[i][col_count-1], 0); + lowest_heights[i][col_count-1] = height_map[i][col_count-1]; + } + + for j in 0..col_count { + // minus to in order to get min with the max heap + vh.insert((0, j), -height_map[0][j], 0); + lowest_heights[0][j] = height_map[0][j]; + + vh.insert((row_count - 1, j), -height_map[row_count - 1][j], 0); + lowest_heights[row_count - 1][j] = height_map[row_count - 1][j]; + } + + let mut result : i32 = 0; + while vh.len() != 0 { + let &((i, j), height, _) = vh.max().unwrap(); + let height = - height; + vh.remove(&(i,j)); + + // for any neighbor of cell (i,j), classify its boundary paths into: + // (1) Paths which includes cell (i,j) + // (2) Paths without cell (i,j) + // We already know the min among the max height of each path in (1) as lowest_heights[i][j], + // We know each path in (2) must pass a cell in vh. Due to the priority queue nature, their height is >= lowest_heights[i]. + + // if height of the neighbor < lowest_heights[i][j]: + // this cell can hold the water. + // lowest_heights[neighbor] = lowest_heights[i][j]; + // else: + // lowest_heights[neighbor]=height[neighbor], this optimal equal case achieves due to the presence of path (1), whose including cell heights are all <= lowest_heights[i][j]. + if i+1 < row_count && lowest_heights[i+1][j] == -1 { + if height_map[i+1][j] < lowest_heights[i][j] { + result += lowest_heights[i][j] - height_map[i+1][j]; + lowest_heights[i+1][j] = lowest_heights[i][j]; + } else { + lowest_heights[i+1][j] = height_map[i+1][j]; + } + vh.insert((i+1,j), -lowest_heights[i+1][j], 0); + } + + if 0 < i && lowest_heights[i-1][j] == -1 { + if height_map[i-1][j] < lowest_heights[i][j] { + result += lowest_heights[i][j] - height_map[i-1][j]; + lowest_heights[i-1][j] = lowest_heights[i][j]; + } else { + lowest_heights[i-1][j] = height_map[i-1][j]; + } + vh.insert((i-1,j), -lowest_heights[i-1][j], 0); + } + + if j+1 < col_count && lowest_heights[i][j+1] == -1 { + if height_map[i][j+1] < lowest_heights[i][j] { + result += lowest_heights[i][j] - height_map[i][j+1]; + lowest_heights[i][j+1] = lowest_heights[i][j]; + } else { + lowest_heights[i][j+1] = height_map[i][j+1]; + } + vh.insert((i,j+1), -lowest_heights[i][j+1], 0); + } + + if 0 < j && lowest_heights[i][j-1] == -1 { + if height_map[i][j-1] < lowest_heights[i][j] { + result += lowest_heights[i][j] - height_map[i][j-1]; + lowest_heights[i][j-1] = lowest_heights[i][j]; + } else { + lowest_heights[i][j-1] = height_map[i][j-1]; + } + vh.insert((i,j-1), -lowest_heights[i][j-1], 0); + } + } + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_407() { + assert_eq!(Solution::trap_rain_water(vec![vec![1,4,3,1,3,2],vec![3,2,1,3,2,4],vec![2,3,3,2,3,1]]), 4); + + assert_eq!(Solution::trap_rain_water(vec![vec![3,3,3,3,3],vec![3,2,2,2,3],vec![3,2,1,2,3],vec![3,2,2,2,3],vec![3,3,3,3,3]]), 10); + + assert_eq!(Solution::trap_rain_water(vec![vec![14,17,18,16,14,16],vec![17,3,10,2,3,8],vec![11,10,4,7,1,7],vec![13,7,2,9,8,10],vec![13,1,3,4,8,6],vec![20,3,3,9,10,8]]), 25); + } +} diff --git a/src/problem/p0410_split_array_largest_sum.rs b/src/problem/p0410_split_array_largest_sum.rs new file mode 100644 index 00000000..b29eb905 --- /dev/null +++ b/src/problem/p0410_split_array_largest_sum.rs @@ -0,0 +1,84 @@ +/** + * [410] Split Array Largest Sum + * + * Given an array nums which consists of non-negative integers and an integer m, you can split the array into m non-empty continuous subarrays. + * Write an algorithm to minimize the largest sum among these m subarrays. + * + * Example 1: + * + * Input: nums = [7,2,5,10,8], m = 2 + * Output: 18 + * Explanation: + * There are four ways to split nums into two subarrays. + * The best way is to split it into [7,2,5] and [10,8], + * where the largest sum among the two subarrays is only 18. + * + * Example 2: + * + * Input: nums = [1,2,3,4,5], m = 2 + * Output: 9 + * + * Example 3: + * + * Input: nums = [1,4,4], m = 3 + * Output: 4 + * + * + * Constraints: + * + * 1 <= nums.length <= 1000 + * 0 <= nums[i] <= 10^6 + * 1 <= m <= min(50, nums.length) + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/split-array-largest-sum/ +// discuss: https://leetcode.com/problems/split-array-largest-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn valid(nums: &Vec, m: i32, sub_sum: i32) -> bool { + let mut cur_sum = 0; + let mut break_count = 0; + for &num in nums { + cur_sum += num; + if sub_sum < cur_sum { + cur_sum = num; + break_count += 1; + if m-1 < break_count {return false} + } + } + true + } + + pub fn split_array(nums: Vec, m: i32) -> i32 { + let max = *nums.iter().max().unwrap(); + let sum = nums.iter().sum(); + + let mut low = max; + let mut high = sum; + while low != high { + let mid = (low+high) / 2; + if Self::valid(&nums, m, mid) { + high = mid ; + } else { + low = mid + 1; + } + } + low + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_410() { + assert_eq!(Solution::split_array(vec![7,2,5,10,8], 2), 18); + } +} diff --git a/src/problem/p0416_partition_equal_subset_sum.rs b/src/problem/p0416_partition_equal_subset_sum.rs new file mode 100644 index 00000000..acd3716d --- /dev/null +++ b/src/problem/p0416_partition_equal_subset_sum.rs @@ -0,0 +1,100 @@ +use std::usize; + +/** + * [416] Partition Equal Subset Sum + * + * Given a non-empty array nums containing only positive integers, find if the array can be partitioned into two subsets such that the sum of elements in both subsets is equal. + * + * Example 1: + * + * Input: nums = [1,5,11,5] + * Output: true + * Explanation: The array can be partitioned as [1, 5, 5] and [11]. + * + * Example 2: + * + * Input: nums = [1,2,3,5] + * Output: false + * Explanation: The array cannot be partitioned into equal sum subsets. + * + * + * Constraints: + * + * 1 <= nums.length <= 200 + * 1 <= nums[i] <= 100 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/partition-equal-subset-sum/ +// discuss: https://leetcode.com/problems/partition-equal-subset-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn can_partition(nums: Vec) -> bool { + let mut sum = 0; + for &num in &nums { + sum += num; + } + if (sum % 2 == 1) {return false; } + let target = (sum / 2) as usize; + let num_count = nums.len(); + let mut result = vec![vec![false;target+1];num_count + 1]; + // result[i][j] imply whether possible to use the subsets of first i elements to reach the target sum j. + + result[0][0] = true; + for i in 1..=num_count { + result[i][0] = true; + for j in 1..=target { + let this_num = nums[i-1] as usize; + if this_num <= j { + result[i][j] = result[i-1][j] || result[i-1][j-this_num]; + } else { + result[i][j] = result[i-1][j]; + } + } + } + + result[num_count][target] + } + // pub fn can_partition(nums: Vec) -> bool { + // let mut sum = 0; + // for &num in &nums { + // sum += num; + // } + // if (sum % 2 == 1) {return false; } + + // let mut result = vec![false; (sum/2) as usize + 1]; + // result[0] = true; + + // after each iteration at i, result[j] indicates whether + // there exists a subset from the first i elements that sum to j + // for &num in &nums { + // for s in (num..=sum/2).rev() { + // Note: we iterate s in opposite order. + // This is because when updating result[s], + // we wanna read result[s-num] updated in the previous iteration. + // The increasing order of s may update result[s-num] first and then updat results[s]. During the latter's update, the accessed result[s-num] no longer represents for the previous iteration. + // let s= s as usize; + // let num = num as usize; + // result[s] = result[s] || result[s-num]; + // } + // } + + // result[(sum/2) as usize] + // } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_416() { + assert!(Solution::can_partition(vec![1,5,11,5])); + assert!(!Solution::can_partition(vec![1,2,3,5])); + } +} diff --git a/src/problem/p0420_strong_password_checker.rs b/src/problem/p0420_strong_password_checker.rs new file mode 100644 index 00000000..d8ec478b --- /dev/null +++ b/src/problem/p0420_strong_password_checker.rs @@ -0,0 +1,165 @@ +/** + * [420] Strong Password Checker + * + * A password is considered strong if the below conditions are all met: + * + * It has at least 6 characters and at most 20 characters. + * It contains at least one lowercase letter, at least one uppercase letter, and at least one digit. + * It does not contain three repeating characters in a row (i.e., "...aaa..." is weak, but "...aa...a..." is strong, assuming other conditions are met). + * + * Given a string password, return the minimum number of steps required to make password strong. if password is already strong, return 0. + * In one step, you can: + * + * Insert one character to password, + * Delete one character from password, or + * Replace one character of password with another character. + * + * + * Example 1: + * Input: password = "a" + * Output: 5 + * Example 2: + * Input: password = "aA1" + * Output: 3 + * Example 3: + * Input: password = "1337C0d3" + * Output: 0 + * + * Constraints: + * + * 1 <= password.length <= 50 + * password consists of letters, digits, dot '.' or exclamation mark '!'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/strong-password-checker/ +// discuss: https://leetcode.com/problems/strong-password-checker/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn strong_password_checker(password: String) -> i32 { + // each insertion or replacement can reduce a triplet. + let mut triplet_count : usize = 0; + + // streak with 3n consecutive char, each streak requires for a single char removal to reduce a triplet. Then it results into a n3_2 streak + let mut n3_0_streak_count : usize = 0; + + // streak with 3n+1 consecutive char, each streak requires for two-char removal to reduce a triplet. Then it results into a n3_2 streak. + let mut n3_1_streak_count : usize = 0; + + // streak with 3n+2 consecutive char, each streak allows for three-char removal to reduce a triplet. Then it is still a n3_2 streak. + let mut n3_2_streak_count : usize = 0; + let mut missed_type_count : usize = 0; + + let len : usize = password.len(); + let mut needed_lower : usize = 1; + let mut needed_upper : usize = 1; + let mut needed_digit : usize = 1; + + for c in password.chars() { + if c.is_ascii_digit() { + needed_digit = 0; + } + if c.is_ascii_lowercase() { + needed_lower = 0; + } + if c.is_ascii_uppercase() { + needed_upper = 0; + } + } + + // For each needed types, there need 1 insertion/replacement. + let needed_types = needed_digit + needed_lower + needed_upper; + + let mut last_char : char = ' '; // any char not exist in password + let mut last_len : usize = 0; + for c in password.chars() { + if c == last_char { + last_len += 1; + } else { + if last_len >= 3 { + println!("last_len={}, last_char={}", last_len, last_char); + triplet_count += last_len / 3; + if last_len % 3 == 0 { + n3_0_streak_count+=1; + } else if last_len % 3 == 1 { + n3_1_streak_count+=1; + } else if last_len % 3 == 2 { + n3_2_streak_count +=1; + } + } + last_len = 1; + last_char = c; + } + } + + if last_len >= 3 { + println!("last_len={}, last_char={}", last_len, last_char); + triplet_count += last_len / 3; + if last_len % 3 == 0 { + n3_0_streak_count+=1; + } else if last_len % 3 == 1 { + n3_1_streak_count+=1; + } else if last_len % 3 == 2 { + n3_2_streak_count +=1; + } + } + + println!("len={}, missed_type_count: {}, triplet_count: {}, n3_0_count: {}, n3_1_count:{}, n3_2_count:{}", len, missed_type_count, triplet_count, n3_0_streak_count, n3_1_streak_count, n3_2_streak_count); + + let min_len : usize = 6; + let max_len : usize = 20; + if len < min_len { + let needed_insertion : usize = min_len - len; + // Char insertion to achieve all + // * Reach the min_len + // * Reduce a triplet + // * Add a missed type. + *[needed_insertion, triplet_count, needed_types].iter().max().unwrap() as i32 + } else if len <= max_len { + // Char replacement to achieve both + // * Reduce a triplet + // * Add a missed type. + *[triplet_count, needed_types].iter().max().unwrap() as i32 + } else { + let needed_removal : usize = len - max_len; + let mut removal_quota : usize = len - max_len; + // Attempt to reduce triplet by char removal with the provided quota, rather than insertion/replacement. + // Start from n3_0 streak, then n3_1, n3_2, as n3_0 streak require the least char removal to reduce a triplet. + + let n3_0_reduced_triplet : usize = std::cmp::min(removal_quota, n3_0_streak_count); + triplet_count -= n3_0_reduced_triplet; + removal_quota -= n3_0_reduced_triplet; + + let n3_1_reduced_triplet : usize = std::cmp::min(removal_quota / 2, n3_1_streak_count); + triplet_count -= n3_1_reduced_triplet; + removal_quota -= n3_1_reduced_triplet * 2; + + // the remaining triplets are all from n3_2 streak, since the above typed streaks have all been transformed into n3_2 streaks. + let n3_2_reduced_triplet : usize = std::cmp::min(removal_quota / 3, triplet_count); + triplet_count -= n3_2_reduced_triplet; // the remaining triplet that have to reduced by replacement. + removal_quota -= n3_2_reduced_triplet * 3; + + needed_removal as i32 + *[triplet_count, needed_types].iter().max().unwrap() as i32 + } + + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_420() { + assert_eq!(Solution::strong_password_checker("bbaaaaaaaaaaaaaaacccccc".to_owned()), 8); + // assert_eq!(Solution::strong_password_checker("aaa111".to_owned()), 2); + // assert_eq!(Solution::strong_password_checker("a".to_owned()), 5); + // assert_eq!(Solution::strong_password_checker("aA1".to_owned()), 3); + // assert_eq!(Solution::strong_password_checker("1337C0d3".to_owned()), 0); + } +} diff --git a/src/problem/p0421_maximum_xor_of_two_numbers_in_an_array.rs b/src/problem/p0421_maximum_xor_of_two_numbers_in_an_array.rs new file mode 100644 index 00000000..58f27095 --- /dev/null +++ b/src/problem/p0421_maximum_xor_of_two_numbers_in_an_array.rs @@ -0,0 +1,89 @@ + +/** + * [421] Maximum XOR of Two Numbers in an Array + * + * Given an integer array nums, return the maximum result of nums[i] XOR nums[j], where 0 ≤ i ≤ j < n. + * Follow up: Could you do this in O(n) runtime? + * + * Example 1: + * + * Input: nums = [3,10,5,25,2,8] + * Output: 28 + * Explanation: The maximum result is 5 XOR 25 = 28. + * Example 2: + * + * Input: nums = [0] + * Output: 0 + * + * Example 3: + * + * Input: nums = [2,4] + * Output: 6 + * + * Example 4: + * + * Input: nums = [8,10,2] + * Output: 10 + * + * Example 5: + * + * Input: nums = [14,70,53,83,49,91,36,80,92,51,66,70] + * Output: 127 + * + * + * Constraints: + * + * 1 <= nums.length <= 2 * 10^4 + * 0 <= nums[i] <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/maximum-xor-of-two-numbers-in-an-array/ +// discuss: https://leetcode.com/problems/maximum-xor-of-two-numbers-in-an-array/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::collections::HashSet; +impl Solution { + // For each iteration at i, we assume to the left parts from i-th digit of the final result, as max_result. + // We try to examine whether [max_result][10000.0] can be attainable. + // If so, max_result = [max_result][10000.0], else [max_result][o0000.0] for the next iteration. + + pub fn find_maximum_xor(nums: Vec) -> i32 { + let mut max_result = 0; + let mut mask = 0; + for i in (0..32usize).rev() { + mask = mask | (1 << i); // mask to get leftmost i digits + let mut exists = HashSet::new(); + let guess = max_result | (1 << i); + // println!("i:{}, mask: {}, max_result={}, guess={}, exists={:?}", i, mask, max_result, guess, exists); + for &num in &nums { + // println!("\texists: num={}, num&mask={}", num, num&mask); + exists.insert(num & mask); + } + + for &num in &nums { + // println!("\tcheck: num={}, num^mask={}", num, num ^ guess); + if exists.contains(&(num & mask ^ guess)) { + max_result = guess; + break; + } + } + // println!(""); + } + max_result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_421() { + assert_eq!(Solution::find_maximum_xor(vec![3,10,5,25,2,8]), 28) + } +} diff --git a/src/problem/p0424_longest_repeating_character_replacement.rs b/src/problem/p0424_longest_repeating_character_replacement.rs new file mode 100644 index 00000000..2be46220 --- /dev/null +++ b/src/problem/p0424_longest_repeating_character_replacement.rs @@ -0,0 +1,92 @@ +/** + * [424] Longest Repeating Character Replacement + * + * Given a string s that consists of only uppercase English letters, you can perform at most k operations on that string. + * + * In one operation, you can choose any character of the string and change it to any other uppercase English character. + * + * Find the length of the longest sub-string containing all repeating letters you can get after performing the above operations. + * + * Note:
+ * Both the string's length and k will not exceed 10^4. + * + * Example 1: + * + * + * Input: + * s = "ABAB", k = 2 + * + * Output: + * 4 + * + * Explanation: + * Replace the two 'A's with two 'B's or vice versa. + * + * + * + * + * Example 2: + * + * + * Input: + * s = "AABABBA", k = 1 + * + * Output: + * 4 + * + * Explanation: + * Replace the one 'A' in the middle with 'B' and form "AABBBBA". + * The substring "BBBB" has the longest repeating letters, which is 4. + * + * + * + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/longest-repeating-character-replacement/ +// discuss: https://leetcode.com/problems/longest-repeating-character-replacement/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +impl Solution { + pub fn character_replacement(s: String, k: i32) -> i32 { + let ss : Vec = s.chars().map(|x|{x as usize}).collect(); + let k = k as usize; + let mut start = 0usize; + let mut end = 0usize; + // in the considered substr. + let mut char_counts = vec![0; 128]; + let mut cur_max = 0usize; + while end < s.len() { + let end_char = ss[end]; + char_counts[end_char]+=1; + // println!("END ss[{}]={}", end, end_char as u8 as char); + // println!("char_count={}, max_char_count={}", char_counts.iter().sum::(), *char_counts.iter().max().unwrap()); + while char_counts.iter().sum::() - *char_counts.iter().max().unwrap() > k { + let start_char = ss[start]; + // println!(" START ss[{}]={}", start, start_char as u8 as char); + char_counts[start_char]-=1; + // println!(" char_count={}, max_char_count{}", char_counts.iter().sum::(), *char_counts.iter().max().unwrap()); + start+=1; + + } + cur_max = std::cmp::max(cur_max, char_counts.iter().sum()); + end+=1; + + } + cur_max as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_424() { + assert_eq!(Solution::character_replacement("ABAB".to_owned(), 2), 4); + assert_eq!(Solution::character_replacement("AABABBA".to_owned(), 1), 4); + } +} diff --git a/src/problem/p0432_all_oone_data_structure.rs b/src/problem/p0432_all_oone_data_structure.rs new file mode 100644 index 00000000..996be650 --- /dev/null +++ b/src/problem/p0432_all_oone_data_structure.rs @@ -0,0 +1,180 @@ +/** + * [432] All O`one Data Structure + * + * Design a data structure to store the strings' count with the ability to return the strings with minimum and maximum counts. + * Implement the AllOne class: + * + * AllOne() Initializes the object of the data structure. + * inc(String key) Increments the count of the string key by 1. If key does not exist in the data structure, insert it with count 1. + * dec(String key) Decrements the count of the string key by 1. If the count of key is 0 after the decrement, remove it from the data structure. It is guaranteed that key exists in the data structure before the decrement. + * getMaxKey() Returns one of the keys with the maximal count. If no element exists, return an empty string "". + * getMinKey() Returns one of the keys with the minimum count. If no element exists, return an empty string "". + * + * + * Example 1: + * + * Input + * ["AllOne", "inc", "inc", "getMaxKey", "getMinKey", "inc", "getMaxKey", "getMinKey"] + * [[], ["hello"], ["hello"], [], [], ["leet"], [], []] + * Output + * [null, null, null, "hello", "hello", null, "hello", "leet"] + * Explanation + * AllOne allOne = new AllOne(); + * allOne.inc("hello"); + * allOne.inc("hello"); + * allOne.getMaxKey(); // return "hello" + * allOne.getMinKey(); // return "hello" + * allOne.inc("leet"); + * allOne.getMaxKey(); // return "hello" + * allOne.getMinKey(); // return "leet" + * + * + * Constraints: + * + * 1 <= key.length <= 10 + * key consists of lowercase English letters. + * It is guaranteed that for each call to dec, key is existing in the data structure. + * At most 3 * 10^4 calls will be made to inc, dec, getMaxKey, and getMinKey. + * + * + * Follow up: Could you apply all the operations in O(1) time complexity? + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/all-oone-data-structure/ +// discuss: https://leetcode.com/problems/all-oone-data-structure/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +use std::collections::BTreeMap; + +struct AllOne { + freq_list : BTreeMap>, + str2freq_pos : HashMap +} + +/** + * `&self` means the method takes an immutable reference. + * If you need a mutable reference, change it to `&mut self` instead. + */ +impl AllOne { + + /** Initialize your data structure here. */ + fn new() -> Self { + AllOne{freq_list : BTreeMap::new(), str2freq_pos : HashMap::new()} + } + + /** Inserts a new key with value 1. Or increments an existing key by 1. */ + fn inc(&mut self, key: String) { + let mut prev_frq : usize = 0; + if let Some(&(frq, pos)) = self.str2freq_pos.get(&key) { + prev_frq = frq; + self.remove(frq, pos); + } + self.insert(prev_frq + 1, &key); + } + + fn insert(&mut self, frq : usize, key : &String) { + if !self.freq_list.contains_key(&frq) { + self.freq_list.insert(frq, vec![]); + } + + let pos : usize = self.freq_list[&frq].len(); + self.freq_list.get_mut(&frq).unwrap().push(key.clone()); + self.str2freq_pos.insert(key.clone(), (frq, pos)); + } + + fn remove(&mut self, frq : usize, pos : usize) { + let removed_key : String = self.freq_list[&frq][pos].clone(); + self.str2freq_pos.remove(&removed_key); + if pos == self.freq_list[&frq].len() - 1 { + let last_key : String = self.freq_list.get_mut(&frq).unwrap().pop().unwrap(); + if self.freq_list[&frq].len() == 0 { + self.freq_list.remove(&frq); + } + // last key + } else { + // substitute the removed position with the last key + let last_key : String = self.freq_list.get_mut(&frq).unwrap().pop().unwrap(); + self.str2freq_pos.insert(last_key.clone(), (frq, pos)); + self.freq_list.get_mut(&frq).unwrap()[pos] = last_key; + } + } + + /** Decrements an existing key by 1. If Key's value is 1, remove it from the data structure. */ + fn dec(&mut self, key: String) { + let (frq, pos) = self.str2freq_pos[&key]; + self.remove(frq, pos); + if frq > 1 { + self.insert(frq - 1, &key); + } + } + + /** Returns one of the keys with maximal value. */ + fn get_max_key(&self) -> String { + if let Some((frq, str_list)) = self.freq_list.range(std::ops::RangeFull).next_back() { + str_list.last().unwrap().clone() + } else { + "".to_owned() + } + } + + /** Returns one of the keys with Minimal value. */ + fn get_min_key(&self) -> String { + if let Some((frq, str_list)) = self.freq_list.range(std::ops::RangeFull).next() { + str_list.last().unwrap().clone() + } else { + "".to_owned() + } + } +} + +/** + * Your AllOne object will be instantiated and called as such: + * let obj = AllOne::new(); + * obj.inc(key); + * obj.dec(key); + * let ret_3: String = obj.get_max_key(); + * let ret_4: String = obj.get_min_key(); + */ + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + fn helper(label : String, ops : Vec, parameters : Vec>, outputs : Vec) { + let mut obj = AllOne::new(); + for i in 0..ops.len() { + let op : String = ops[i].clone(); + let output : String = outputs[i].clone(); + + if op == "inc" { + let key : String = parameters[i][0].clone(); + obj.inc(key); + } else if op == "dec" { + let key : String = parameters[i][0].clone(); + obj.dec(key); + } else if op == "getMaxKey" { + let result : String = obj.get_max_key(); + if output != result { + panic!("Inconsistent output: i={}, op={}, output={}, actual={}", i, op, output, result); + } + } else if op == "getMinKey" { + let result : String = obj.get_min_key(); + if output != result { + panic!("Inconsistent output: i={}, op={}, output={}, actual={}", i, op, output, result); + } + + } + } + } + + #[test] + fn test_432() { + helper("test1".to_owned(), vec_string!["AllOne", "inc", "inc", "getMaxKey", "getMinKey", "inc", "getMaxKey", "getMinKey"], + vec![vec_string![], vec_string!["hello"], vec_string!["hello"], vec_string![], vec_string![], vec_string!["leet"], vec_string![], vec_string![]], + vec_string!["null", "null", "null", "hello", "hello", "null", "hello", "leet"]); + } +} diff --git a/src/problem/p0436_find_right_interval.rs b/src/problem/p0436_find_right_interval.rs new file mode 100644 index 00000000..e7f649f3 --- /dev/null +++ b/src/problem/p0436_find_right_interval.rs @@ -0,0 +1,107 @@ +/** + * [436] Find Right Interval + * + * You are given an array of intervals, where intervals[i] = [starti, endi] and each starti is unique. + * The right interval for an interval i is an interval j such that startj >= endi and startj is minimized. + * Return an array of right interval indices for each interval i. If no right interval exists for interval i, then put -1 at index i. + * + * Example 1: + * + * Input: intervals = [[1,2]] + * Output: [-1] + * Explanation: There is only one interval in the collection, so it outputs -1. + * + * Example 2: + * + * Input: intervals = [[3,4],[2,3],[1,2]] + * Output: [-1,0,1] + * Explanation: There is no right interval for [3,4]. + * The right interval for [2,3] is [3,4] since start0 = 3 is the smallest start that is >= end1 = 3. + * The right interval for [1,2] is [2,3] since start1 = 2 is the smallest start that is >= end2 = 2. + * + * Example 3: + * + * Input: intervals = [[1,4],[2,3],[3,4]] + * Output: [-1,2,-1] + * Explanation: There is no right interval for [1,4] and [3,4]. + * The right interval for [2,3] is [3,4] since start2 = 3 is the smallest start that is >= end1 = 3. + * + * + * Constraints: + * + * 1 <= intervals.length <= 2 * 10^4 + * intervals[i].length == 2 + * -10^6 <= starti <= endi <= 10^6 + * The start point of each interval is unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/find-right-interval/ +// discuss: https://leetcode.com/problems/find-right-interval/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; + +impl Solution { + pub fn first_ge_start(sorted_intervals: &Vec>, target : i32) -> i32 { + let mut low = 0; + let mut high = (sorted_intervals.len() - 1) as i32; + while low <= high { + let mid = (low + high) / 2; + let mid_start = sorted_intervals[mid as usize][0]; + if target <= mid_start { + if mid == 0 || !target <= sorted_intervals[(mid-1) as usize][0] { + return mid; + } + high = mid - 1; + } else { + low = mid + 1; + } + } + -1 + } + + pub fn find_right_interval(intervals: Vec>) -> Vec { + let mut original_pos = HashMap::new(); + for (i, interval) in intervals.iter().enumerate() { + original_pos.insert(interval[0], i as i32); + } + + // println!("original intervals: {:?}", intervals); + // println!("original_pos: {:?}", original_pos); + + let mut sorted_intervals = intervals.clone(); + sorted_intervals.sort_by(|a,b|{a[0].cmp(&b[0])}); + // println!("sorted intervals: {:?}", sorted_intervals); + + let mut result = vec![]; + for (i, interval) in intervals.iter().enumerate() { + + let target = interval[1]; + let result_sorted_idx = Self::first_ge_start(&sorted_intervals, target); + + if result_sorted_idx == -1 { + result.push(-1); + } else { + let target_start = sorted_intervals[result_sorted_idx as usize][0]; + result.push(*original_pos.get(&target_start).unwrap()); + } + } + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_436() { + assert_eq!(Solution::find_right_interval(vec![vec![3,4], vec![2,3], vec![1,2]]), vec![-1,0,1]); + assert_eq!(Solution::find_right_interval(vec![vec![4,5], vec![2,3], vec![1,2]]), vec![-1,0,1]); + } +} diff --git a/src/problem/p0440_k_th_smallest_in_lexicographical_order.rs b/src/problem/p0440_k_th_smallest_in_lexicographical_order.rs new file mode 100644 index 00000000..e5b5e838 --- /dev/null +++ b/src/problem/p0440_k_th_smallest_in_lexicographical_order.rs @@ -0,0 +1,67 @@ +/** + * [440] K-th Smallest in Lexicographical Order + * + * Given two integers n and k, return the k^th lexicographically smallest integer in the range [1, n]. + * + * Example 1: + * + * Input: n = 13, k = 2 + * Output: 10 + * Explanation: The lexicographical order is [1, 10, 11, 12, 13, 2, 3, 4, 5, 6, 7, 8, 9], so the second smallest number is 10. + * + * Example 2: + * + * Input: n = 1, k = 1 + * Output: 1 + * + * + * Constraints: + * + * 1 <= k <= n <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/k-th-smallest-in-lexicographical-order/ +// discuss: https://leetcode.com/problems/k-th-smallest-in-lexicographical-order/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_kth_number(n: i32, k: i32) -> i32 { + let mut k = k - 1; + let mut cur : i32 = 1; + while 0 < k { + let step : i32 = Self::cal_steps(n as i64, cur as i64, cur as i64 + 1) as i32; + if step <= k { + k -= step; + cur += 1; + } else { + k -= 1; + cur *= 10; + } + } + cur + } + + pub fn cal_steps(n : i64, mut level_start : i64, mut level_end : i64) -> i64 { + let mut steps : i64 = 0; + while level_start <= n { + steps += std::cmp::min(n + 1, level_end) - level_start; + level_start *= 10; + level_end *= 10; + } + steps + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_440() { + } +} diff --git a/src/problem/p0445_add_two_numbers_ii.rs b/src/problem/p0445_add_two_numbers_ii.rs new file mode 100644 index 00000000..de70da20 --- /dev/null +++ b/src/problem/p0445_add_two_numbers_ii.rs @@ -0,0 +1,166 @@ +/** + * [445] Add Two Numbers II + * + * You are given two non-empty linked lists representing two non-negative integers. The most significant digit comes first and each of their nodes contain a single digit. Add the two numbers and return it as a linked list. + * + * You may assume the two numbers do not contain any leading zero, except the number 0 itself. + * + * Follow up:
+ * What if you cannot modify the input lists? In other words, reversing the lists is not allowed. + * + * + * + * Example: + * + * Input: (7 -> 2 -> 4 -> 3) + (5 -> 6 -> 4) + * Output: 7 -> 8 -> 0 -> 7 + * + * + */ +pub struct Solution {} +use crate::util::linked_list::{ListNode, to_list}; + +// problem: https://leetcode.com/problems/add-two-numbers-ii/ +// discuss: https://leetcode.com/problems/add-two-numbers-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for singly-linked list. +// #[derive(PartialEq, Eq, Clone, Debug)] +// pub struct ListNode { +// pub val: i32, +// pub next: Option> +// } +// +// impl ListNode { +// #[inline] +// fn new(val: i32) -> Self { +// ListNode { +// next: None, +// val +// } +// } +// } +impl Solution { + pub fn add_equal_len(mut l1: Box, mut l2: Box) -> (i32, Box) { + // let head = Box::new(ListNode::new()); + if l1.next.is_some() && l2.next.is_some() { + let (prev_carry, mut prev_head) = Self::add_equal_len(l1.next.unwrap(), l2.next.unwrap()); + let carry = (l1.val + l2.val + prev_carry) / 10; + let val = (l1.val + l2.val + prev_carry) % 10; + let mut this_node = Box::new(ListNode::new(val)); + this_node.next = Some(prev_head); + return (carry, this_node); + } else { + let carry = (l1.val + l2.val) / 10; + let val = (l1.val + l2.val) % 10; + let mut this_node = Box::new(ListNode::new(val)); + return (carry, this_node); + } + } + + pub fn add_carry_append_tail(l1: Option>, carry: i32, tail_head: Box) -> (i32, Option>) { + if let Some(l1_node) = l1 { + if let None = l1_node.next { + let this_carry = (carry + l1_node.val) / 10; + let this_val = (carry + l1_node.val) % 10; + let mut this_node = Box::new(ListNode::new(this_val)); + this_node.next = Some(tail_head); + return (this_carry, Some(this_node)); + } else { + let (prev_carry, prev_tail) = Self::add_carry_append_tail(l1_node.next, carry, tail_head); + + let this_carry = (prev_carry + l1_node.val) / 10; + let this_val = (prev_carry + l1_node.val) % 10; + let mut this_node = Box::new(ListNode::new(this_val)); + this_node.next = prev_tail; + return (this_carry, Some(this_node)); + } + } else if 0 < carry { + let mut this_node = Some(Box::new(ListNode::new(carry))); + this_node.as_mut().unwrap().next = Some(tail_head); + return (0, this_node); + } else { + return (0, Some(tail_head)); + } + } + + pub fn add_two_numbers(l1: Option>, l2: Option>) -> Option> { + // Find the size of two lists. + let (mut l1_size, mut l2_size) = (0, 0); + let mut l1_node = l1.as_ref(); + while let Some(node) = l1_node { + l1_size+=1; + l1_node = node.next.as_ref(); + } + + let mut l2_node = l2.as_ref(); + while let Some(node) = l2_node { + l2_size+=1; + l2_node = node.next.as_ref(); + } + + let (mut shorter, mut longer) : (Option>, Option>); + let mut diff = 0; + if l1_size < l2_size { + shorter = l1; + longer = l2; + diff = l2_size - l1_size; + } else { + shorter = l2; + longer = l1; + diff = l1_size - l2_size; + } + + // Truncate the longer list into two parts. The second is of equal size of the smaller list. Box + // let mut first_part_tail = longer.as_mut().unwrap(); + let first_part_head : Option>; + let sec_part_head : Option>; + if diff == 0 { + first_part_head = None; + sec_part_head = longer; + } else { + diff -=1; + let mut first_part_tail = longer.as_mut().unwrap(); + while 0 < diff { + // println!("diff = {}, node val = {}", diff, first_part_tail.val); + first_part_tail = first_part_tail.next.as_mut().unwrap(); + diff -=1; + } // end while + sec_part_head = first_part_tail.next.take(); + first_part_head = longer; + } + + // Sum two lists of equal length + let (carry, tail_node) = Self::add_equal_len(sec_part_head.unwrap(),shorter.unwrap()); + // Add carry to the first halve and append the above list to the tail. + let (carry, head) = Self::add_carry_append_tail(first_part_head, carry, tail_node); + if 0 < carry { + let mut this_node = Box::new(ListNode::new(carry)); + this_node.next = head; + return Some(this_node); + } else { + return head; + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_445() { + // assert_eq!( + // Solution::add_two_numbers(linked![7, 2, 4, 3], linked![5, 6, 4]), + // linked![7, 8, 0, 7] + // ); + assert_eq!( + Solution::add_two_numbers(linked![9, 1, 6], linked![0]), + linked![9, 1, 6] + ) + + } +} diff --git a/src/problem/p0446_arithmetic_slices_ii_subsequence.rs b/src/problem/p0446_arithmetic_slices_ii_subsequence.rs new file mode 100644 index 00000000..156efe28 --- /dev/null +++ b/src/problem/p0446_arithmetic_slices_ii_subsequence.rs @@ -0,0 +1,86 @@ +/** + * [446] Arithmetic Slices II - Subsequence + * + * Given an integer array nums, return the number of all the arithmetic subsequences of nums. + * A sequence of numbers is called arithmetic if it consists of at least three elements and if the difference between any two consecutive elements is the same. + * + * For example, [1, 3, 5, 7, 9], [7, 7, 7, 7], and [3, -1, -5, -9] are arithmetic sequences. + * For example, [1, 1, 2, 5, 7] is not an arithmetic sequence. + * + * A subsequence of an array is a sequence that can be formed by removing some elements (possibly none) of the array. + * + * For example, [2,5,10] is a subsequence of [1,2,1,2,4,1,5,10]. + * + * The answer is guaranteed to fit in 32-bit integer. + * + * Example 1: + * + * Input: nums = [2,4,6,8,10] + * Output: 7 + * Explanation: All arithmetic subsequence slices are: + * [2,4,6] + * [4,6,8] + * [6,8,10] + * [2,4,6,8] + * [4,6,8,10] + * [2,4,6,8,10] + * [2,6,10] + * + * Example 2: + * + * Input: nums = [7,7,7,7,7] + * Output: 16 + * Explanation: Any subsequence of this array is arithmetic. + * + * + * Constraints: + * + * 1 <= nums.length <= 1000 + * -2^31 <= nums[i] <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/arithmetic-slices-ii-subsequence/ +// discuss: https://leetcode.com/problems/arithmetic-slices-ii-subsequence/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::collections::HashMap; +impl Solution { + pub fn number_of_arithmetic_slices(nums: Vec) -> i32 { + let n : usize = nums.len(); + let nums : Vec = nums.into_iter().map(|x|{x as i64}).collect(); + // counts[i][d] counts the number of arithmetic subsequences ending at nums[i] with diff d. + // the sequence can be of length 2. + let mut counts : Vec> = vec![HashMap::new();n]; + let mut result : usize = 0; + for i in 1..n { + for j in 0..i { + let diff : i64 = nums[i] - nums[j]; + let mut prev : usize = 0; + if let Some(&prev_count) = counts[j].get(&diff) { + prev = prev_count; + } + + // +1 to account for two-value subsequence with [num[j], num[i]] + *counts[i].entry(diff).or_insert(0usize) += prev + 1; + result += prev; + } + } + result as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_446() { + assert_eq!(Solution::number_of_arithmetic_slices(vec![2,4,6,8,10]), 7); + assert_eq!(Solution::number_of_arithmetic_slices(vec![7,7,7,7,7]), 16); + } +} diff --git a/src/problem/p0447_number_of_boomerangs.rs b/src/problem/p0447_number_of_boomerangs.rs new file mode 100644 index 00000000..d364fa09 --- /dev/null +++ b/src/problem/p0447_number_of_boomerangs.rs @@ -0,0 +1,83 @@ +/** + * [447] Number of Boomerangs + * + * You are given n points in the plane that are all distinct, where points[i] = [xi, yi]. A boomerang is a tuple of points (i, j, k) such that the distance between i and j equals the distance between i and k (the order of the tuple matters). + * Return the number of boomerangs. + * + * Example 1: + * + * Input: points = [[0,0],[1,0],[2,0]] + * Output: 2 + * Explanation: The two boomerangs are [[1,0],[0,0],[2,0]] and [[1,0],[2,0],[0,0]]. + * + * Example 2: + * + * Input: points = [[1,1],[2,2],[3,3]] + * Output: 2 + * + * Example 3: + * + * Input: points = [[1,1]] + * Output: 0 + * + * + * Constraints: + * + * n == points.length + * 1 <= n <= 500 + * points[i].length == 2 + * -10^4 <= xi, yi <= 10^4 + * All the points are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/number-of-boomerangs/ +// discuss: https://leetcode.com/problems/number-of-boomerangs/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; + +impl Solution { + + pub fn number_of_boomerangs(points: Vec>) -> i32 { + + let n = points.len(); + let mut result = 0; + for i in 0..n { + let mut distance_idxs = HashMap::new(); + for j in 0..n { + if i == j {continue;} + let x_diff = std::cmp::max(points[i][0], points[j][0]) - std::cmp::min(points[i][0], points[j][0]); + let y_diff = std::cmp::max(points[i][1], points[j][1]) - std::cmp::min(points[i][1], points[j][1]); + let distance = x_diff * x_diff + y_diff * y_diff; + if let Some(idx) = distance_idxs.get_mut(&distance) { + *idx += 1; + } else { + distance_idxs.insert(distance, 1 as i32); + } + } + for (_, count) in distance_idxs { + result += count * (count - 1); + } + + } + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_447() { + assert_eq!( + Solution::number_of_boomerangs(vec![vec![0,0], vec![1,0], vec![2,0]]), + 2 + ) + } +} diff --git a/src/problem/p0451_sort_characters_by_frequency.rs b/src/problem/p0451_sort_characters_by_frequency.rs new file mode 100644 index 00000000..71710b7f --- /dev/null +++ b/src/problem/p0451_sort_characters_by_frequency.rs @@ -0,0 +1,91 @@ +/** + * [451] Sort Characters By Frequency + * + * Given a string, sort it in decreasing order based on the frequency of characters. + * + * Example 1: + * + * Input: + * "tree" + * + * Output: + * "eert" + * + * Explanation: + * 'e' appears twice while 'r' and 't' both appear once. + * So 'e' must appear before both 'r' and 't'. Therefore "eetr" is also a valid answer. + * + * + * + * Example 2: + * + * Input: + * "cccaaa" + * + * Output: + * "cccaaa" + * + * Explanation: + * Both 'c' and 'a' appear three times, so "aaaccc" is also a valid answer. + * Note that "cacaca" is incorrect, as the same characters must be together. + * + * + * + * Example 3: + * + * Input: + * "Aabb" + * + * Output: + * "bbAa" + * + * Explanation: + * "bbaA" is also a valid answer, but "Aabb" is incorrect. + * Note that 'A' and 'a' are treated as two different characters. + * + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/sort-characters-by-frequency/ +// discuss: https://leetcode.com/problems/sort-characters-by-frequency/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn frequency_sort(s: String) -> String { + let mut frequency = HashMap::new(); + s.chars().for_each(|c| { + if let Some(f) = frequency.get_mut(&c) { + *f += 1; + } else { + frequency.insert(c, 1); + } + }); + + let mut sorted_char = vec![]; + for (&c, &count) in frequency.iter() { + sorted_char.push((count, c)); + } + sorted_char.sort(); + sorted_char.reverse(); + let mut result = String::from(""); + for (count, c) in sorted_char { + for i in 0..count as usize { + result.push(c); + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_451() { + } +} diff --git a/src/problem/p0456_132_pattern.rs b/src/problem/p0456_132_pattern.rs new file mode 100644 index 00000000..60a8639f --- /dev/null +++ b/src/problem/p0456_132_pattern.rs @@ -0,0 +1,71 @@ +/** + * [456] 132 Pattern + * + * Given an array of n integers nums, a 132 pattern is a subsequence of three integers nums[i], nums[j] and nums[k] such that i < j < k and nums[i] < nums[k] < nums[j]. + * Return true if there is a 132 pattern in nums, otherwise, return false. + * Follow up: The O(n^2) is trivial, could you come up with the O(n logn) or the O(n) solution? + * + * Example 1: + * + * Input: nums = [1,2,3,4] + * Output: false + * Explanation: There is no 132 pattern in the sequence. + * + * Example 2: + * + * Input: nums = [3,1,4,2] + * Output: true + * Explanation: There is a 132 pattern in the sequence: [1, 4, 2]. + * + * Example 3: + * + * Input: nums = [-1,3,2,0] + * Output: true + * Explanation: There are three 132 patterns in the sequence: [-1, 3, 2], [-1, 3, 0] and [-1, 2, 0]. + * + * + * Constraints: + * + * n == nums.length + * 1 <= n <= 10^4 + * -10^9 <= nums[i] <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/132-pattern/ +// discuss: https://leetcode.com/problems/132-pattern/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find132pattern(mut nums: Vec) -> bool { + let mut stack = vec![]; + nums.reverse(); + let mut s3 = -10000000; + for e in nums { + if e < s3 { return true; } + while let Some(&last) = stack.last() { + if last < e { + s3 = last; + stack.pop(); + } else { + break + } + } + stack.push(e); + } + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_456() { + } +} diff --git a/src/problem/p0458_poor_pigs.rs b/src/problem/p0458_poor_pigs.rs new file mode 100644 index 00000000..c8a1a628 --- /dev/null +++ b/src/problem/p0458_poor_pigs.rs @@ -0,0 +1,61 @@ +/** + * [458] Poor Pigs + * + * There are buckets buckets of liquid, where exactly one of the buckets is poisonous. To figure out which one is poisonous, you feed some number of (poor) pigs the liquid to see whether they will die or not. Unfortunately, you only have minutesToTest minutes to determine which bucket is poisonous. + * You can feed the pigs according to these steps: + *
    + * Choose some live pigs to feed. + * For each pig, choose which buckets to feed it. The pig will consume all the chosen buckets simultaneously and will take no time. + * Wait for minutesToDie minutes. You may not feed any other pigs during this time. + * After minutesToDie minutes have passed, any pigs that have been fed the poisonous bucket will die, and all others will survive. + * Repeat this process until you run out of time. + *
+ * Given buckets, minutesToDie, and minutesToTest, return the minimum number of pigs needed to figure out which bucket is poisonous within the allotted time. + * + * Example 1: + * Input: buckets = 1000, minutesToDie = 15, minutesToTest = 60 + * Output: 5 + * Example 2: + * Input: buckets = 4, minutesToDie = 15, minutesToTest = 15 + * Output: 2 + * Example 3: + * Input: buckets = 4, minutesToDie = 15, minutesToTest = 30 + * Output: 2 + * + * Constraints: + * + * 1 <= buckets <= 1000 + * 1 <= minutesToDie <= minutesToTest <= 100 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/poor-pigs/ +// discuss: https://leetcode.com/problems/poor-pigs/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn poor_pigs(buckets: i32, minutes_to_die: i32, minutes_to_test: i32) -> i32 { + let mut pig : u32 = 0; + let counter_per_dim : i32 = minutes_to_test / minutes_to_die + 1; + while i32::pow(counter_per_dim, pig) < buckets { + pig+=1; + } + pig as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_458() { + assert_eq!(Solution::poor_pigs(1000, 15, 60), 5); + assert_eq!(Solution::poor_pigs(4, 15, 15), 2); + assert_eq!(Solution::poor_pigs(4, 15, 30), 3); + } +} diff --git a/src/problem/p0460_lfu_cache.py b/src/problem/p0460_lfu_cache.py new file mode 100644 index 00000000..3779b6ce --- /dev/null +++ b/src/problem/p0460_lfu_cache.py @@ -0,0 +1,169 @@ +import collections + +class Node: + def __init__(self, key, val): + self.key = key + self.val = val + self.freq = 1 + self.prev = self.next = None + +class DLinkedList: + """ An implementation of doubly linked list. + + Two APIs provided: + + append(node): append the node to the head of the linked list. + pop(node=None): remove the referenced node. + If None is given, remove the one from tail, which is the least recently used. + + Both operation, apparently, are in O(1) complexity. + """ + def __init__(self): + self._sentinel = Node(None, None) # dummy node + self._sentinel.next = self._sentinel.prev = self._sentinel + self._size = 0 + + def __len__(self): + return self._size + + def append(self, node): + node.next = self._sentinel.next + node.prev = self._sentinel + node.next.prev = node + self._sentinel.next = node + self._size += 1 + + def pop(self, node=None): + if self._size == 0: + return + + if not node: + node = self._sentinel.prev + + node.prev.next = node.next + node.next.prev = node.prev + self._size -= 1 + + return node + +class LFUCache: + def __init__(self, capacity): + """ + :type capacity: int + + Three things to maintain: + + 1. a dict, named as `self._node`, for the reference of all nodes given key. + That is, O(1) time to retrieve node given a key. + + 2. Each frequency has a doubly linked list, store in `self._freq`, where key + is the frequency, and value is an object of `DLinkedList` + + 3. The min frequency through all nodes. We can maintain this in O(1) time, taking + advantage of the fact that the frequency can only increment by 1. Use the following + two rules: + + Rule 1: Whenever we see the size of the DLinkedList of current min frequency is 0, + the min frequency must increment by 1. + + Rule 2: Whenever put in a new (key, value), the min frequency must 1 (the new node) + + """ + self._size = 0 + self._capacity = capacity + + self._node = dict() # key: Node + self._freq = collections.defaultdict(DLinkedList) + self._minfreq = 0 + + + def _update(self, node): + """ + This is a helper function that used in the following two cases: + + 1. when `get(key)` is called; and + 2. when `put(key, value)` is called and the key exists. + + The common point of these two cases is that: + + 1. no new node comes in, and + 2. the node is visited one more times -> node.freq changed -> + thus the place of this node will change + + The logic of this function is: + + 1. pop the node from the old DLinkedList (with freq `f`) + 2. append the node to new DLinkedList (with freq `f+1`) + 3. if old DlinkedList has size 0 and self._minfreq is `f`, + update self._minfreq to `f+1` + + All of the above opeartions took O(1) time. + """ + freq = node.freq + + self._freq[freq].pop(node) + if self._minfreq == freq and not self._freq[freq]: + self._minfreq += 1 + + node.freq += 1 + freq = node.freq + self._freq[freq].append(node) + + def get(self, key): + """ + Through checking self._node[key], we can get the node in O(1) time. + Just performs self._update, then we can return the value of node. + + :type key: int + :rtype: int + """ + if key not in self._node: + return -1 + + node = self._node[key] + self._update(node) + return node.val + + def put(self, key, value): + """ + If `key` already exists in self._node, we do the same operations as `get`, except + updating the node.val to new value. + + Otherwise, the following logic will be performed + + 1. if the cache reaches its capacity, pop the least frequently used item. (*) + 2. add new node to self._node + 3. add new node to the DLinkedList with frequency 1 + 4. reset self._minfreq to 1 + + (*) How to pop the least frequently used item? Two facts: + + 1. we maintain the self._minfreq, the minimum possible frequency in cache. + 2. All cache with the same frequency are stored as a DLinkedList, with + recently used order (Always append at head) + + Consequence? ==> The tail of the DLinkedList with self._minfreq is the least + recently used one, pop it... + + :type key: int + :type value: int + :rtype: void + """ + if self._capacity == 0: + return + + if key in self._node: + node = self._node[key] + self._update(node) + node.val = value + else: + if self._size == self._capacity: + node = self._freq[self._minfreq].pop() + del self._node[node.key] + self._size -= 1 + + node = Node(key, value) + self._node[key] = node + self._freq[1].append(node) + self._minfreq = 1 + self._size += 1 \ No newline at end of file diff --git a/src/problem/p0461_hamming_distance.rs b/src/problem/p0461_hamming_distance.rs new file mode 100644 index 00000000..39085e8f --- /dev/null +++ b/src/problem/p0461_hamming_distance.rs @@ -0,0 +1,57 @@ +/** + * [461] Hamming Distance + * + * The Hamming distance between two integers is the number of positions at which the corresponding bits are different. + * + * Given two integers x and y, calculate the Hamming distance. + * + * Note:
+ * 0 ≤ x, y < 2^31. + * + * + * Example: + * + * Input: x = 1, y = 4 + * + * Output: 2 + * + * Explanation: + * 1 (0 0 0 1) + * 4 (0 1 0 0) + * ↑ ↑ + * + * The above arrows point to positions where the corresponding bits are different. + * + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/hamming-distance/ +// discuss: https://leetcode.com/problems/hamming-distance/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn digit1_count(mut x : i32) -> usize { + let mut count = 0; + while x != 0 { + x = x & (x-1); + count+=1; + } + count + } + pub fn hamming_distance(x: i32, y: i32) -> i32 { + Self::digit1_count(x^y) as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_461() { + } +} diff --git a/src/problem/p0466_count_the_repetitions.rs b/src/problem/p0466_count_the_repetitions.rs new file mode 100644 index 00000000..ed15025b --- /dev/null +++ b/src/problem/p0466_count_the_repetitions.rs @@ -0,0 +1,79 @@ +/** + * [466] Count The Repetitions + * + * We define str = [s, n] as the string str which consists of the string s concatenated n times. + * + * For example, str == ["abc", 3] =="abcabcabc". + * + * We define that string s1 can be obtained from string s2 if we can remove some characters from s2 such that it becomes s1. + * + * For example, s1 = "abc" can be obtained from s2 = "abdbec" based on our definition by removing the bolded underlined characters. + * + * You are given two strings s1 and s2 and two integers n1 and n2. You have the two strings str1 = [s1, n1] and str2 = [s2, n2]. + * Return the maximum integer m such that str = [str2, m] can be obtained from str1. + * + * Example 1: + * Input: s1 = "acb", n1 = 4, s2 = "ab", n2 = 2 + * Output: 2 + * Example 2: + * Input: s1 = "acb", n1 = 1, s2 = "acb", n2 = 1 + * Output: 1 + * + * Constraints: + * + * 1 <= s1.length, s2.length <= 100 + * s1 and s2 consist of lowercase English letters. + * 1 <= n1, n2 <= 10^6 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/count-the-repetitions/ +// discuss: https://leetcode.com/problems/count-the-repetitions/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn get_max_repetitions(s1: String, n1: i32, s2: String, n2: i32) -> i32 { + let s1 : Vec = s1.chars().collect(); + let s2 : Vec = s2.chars().collect(); + + let mut count1 : i32 = 0; + let mut count2 : i32 = 0; + let mut i1 : usize = 0; + let mut i2 : usize = 0; + let mut len1 : usize = s1.len(); + let mut len2 : usize = s2.len(); + + while count1 < n1 { + if s1[i1] == s2[i2] { + i2+=1; + if i2==len2 { + i2 = 0; + count2+=1; + } + } + + i1+=1; + if i1 == len1 { + i1 = 0; + count1+=1; + } + } + count2 / n2 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_466() { + assert_eq!(Solution::get_max_repetitions("acb".to_owned(), 4, "ab".to_owned(), 2), 2); + + assert_eq!(Solution::get_max_repetitions("acb".to_owned(), 1, "acb".to_owned(), 1), 1); + } +} diff --git a/src/problem/p0472_concatenated_words.rs b/src/problem/p0472_concatenated_words.rs new file mode 100644 index 00000000..ad843600 --- /dev/null +++ b/src/problem/p0472_concatenated_words.rs @@ -0,0 +1,81 @@ +/** + * [472] Concatenated Words + * + * Given an array of strings words (without duplicates), return all the concatenated words in the given list of words. + * A concatenated word is defined as a string that is comprised entirely of at least two shorter words in the given array. + * + * Example 1: + * + * Input: words = ["cat","cats","catsdogcats","dog","dogcatsdog","hippopotamuses","rat","ratcatdogcat"] + * Output: ["catsdogcats","dogcatsdog","ratcatdogcat"] + * Explanation: "catsdogcats" can be concatenated by "cats", "dog" and "cats"; + * "dogcatsdog" can be concatenated by "dog", "cats" and "dog"; + * "ratcatdogcat" can be concatenated by "rat", "cat", "dog" and "cat". + * Example 2: + * + * Input: words = ["cat","dog","catdog"] + * Output: ["catdog"] + * + * + * Constraints: + * + * 1 <= words.length <= 10^4 + * 0 <= words[i].length <= 1000 + * words[i] consists of only lowercase English letters. + * 0 <= sum(words[i].length) <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/concatenated-words/ +// discuss: https://leetcode.com/problems/concatenated-words/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashSet; +impl Solution { + pub fn find_all_concatenated_words_in_a_dict(mut words: Vec) -> Vec { + words.sort_by(|a,b|{a.len().cmp(&b.len())}); + + let mut dict : HashSet = HashSet::new(); + let mut result = vec![]; + for word_itr in words.iter() { + if word_itr.len() != 0 && Self::breakable(word_itr.chars().collect(), &dict) { + result.push(word_itr.clone()); + } + dict.insert(word_itr.clone()); + } + result + } + + pub fn breakable(word : Vec, dict : &HashSet) -> bool { + // println!("word={:?}, dict={:?}", word, dict); + let word_len : usize = word.len(); + let mut breakable_at : Vec = vec![false; word_len+1]; + breakable_at[0] = true; + + for i in 1..=word_len { + for j in 0..i { + let sub_word : String = word.iter().skip(j).take(i-j).cloned().collect(); + if breakable_at[j] && dict.contains(&sub_word) { + breakable_at[i] = true; + break; + } + } + } + breakable_at[word_len] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_472() { + assert_eq!(Solution::find_all_concatenated_words_in_a_dict(vec_string!["cat","cats","catsdogcats","dog","dogcatsdog","hippopotamuses","rat","ratcatdogcat"]), vec_string!["dogcatsdog","catsdogcats","ratcatdogcat"]); + + assert_eq!(Solution::find_all_concatenated_words_in_a_dict(vec_string![""]).len(), 0); + } +} diff --git a/src/problem/p0480_sliding_window_median.rs b/src/problem/p0480_sliding_window_median.rs new file mode 100644 index 00000000..758386aa --- /dev/null +++ b/src/problem/p0480_sliding_window_median.rs @@ -0,0 +1,127 @@ +/** + * [480] Sliding Window Median + * + * Median is the middle value in an ordered integer list. If the size of the list is even, there is no middle value. So the median is the mean of the two middle value. + * Examples: + * [2,3,4] , the median is 3 + * [2,3], the median is (2 + 3) / 2 = 2.5 + * Given an array nums, there is a sliding window of size k which is moving from the very left of the array to the very right. You can only see the k numbers in the window. Each time the sliding window moves right by one position. Your job is to output the median array for each window in the original array. + * For example,
+ * Given nums = [1,3,-1,-3,5,3,6,7], and k = 3. + * + * Window position Median + * --------------- ----- + * [1 3 -1] -3 5 3 6 7 1 + * 1 [3 -1 -3] 5 3 6 7 -1 + * 1 3 [-1 -3 5] 3 6 7 -1 + * 1 3 -1 [-3 5 3] 6 7 3 + * 1 3 -1 -3 [5 3 6] 7 5 + * 1 3 -1 -3 5 [3 6 7] 6 + * + * Therefore, return the median sliding window as [1,-1,-1,3,5,6]. + * Note:
+ * You may assume k is always valid, ie: k is always smaller than input array's size for non-empty array.
+ * Answers within 10^-5 of the actual value will be accepted as correct. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/sliding-window-median/ +// discuss: https://leetcode.com/problems/sliding-window-median/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::BTreeMap; +impl Solution { + pub fn median(left_half: &BTreeMap, right_half: &BTreeMap, k : usize) -> f64 { + + // println!("left_half={:?}, right_half={:?}", left_half, right_half); + if k % 2 == 1 { + *right_half.iter().next().unwrap().0 as f64 + } else { + let right_min = *right_half.iter().next().unwrap().0 as f64; + let left_max = *left_half.iter().next_back().unwrap().0 as f64; + (right_min + left_max) / 2f64 + } + } + + pub fn decrement_for_key(half : &mut BTreeMap, key : i32) { + if half.contains_key(&key) { + *half.get_mut(&key).unwrap() -=1; + if half[&key] == 0 { + half.remove(&key); + } + } + } + + pub fn median_sliding_window(nums: Vec, k: i32) -> Vec { + let k = k as usize; + let mut first_k_sorted = nums.split_at(k).0.to_vec(); + first_k_sorted.sort(); + + let mut left_half = BTreeMap::new(); + let mut right_half = BTreeMap::new(); + let mid_num = first_k_sorted[k / 2]; + // println!("first_k_sorted={:?}", first_k_sorted); + + for &num in &first_k_sorted[0..k/2] { + *(left_half.entry(num).or_insert(0))+=1; + } + + for &num in &first_k_sorted[k/2..] { + *(right_half.entry(num).or_insert(0))+=1; + } + + let mut result = vec![]; + result.push(Self::median(&left_half, &right_half, k)); + + for i in k..nums.len() { + let num_to_add = nums[i]; + let num_to_remove = nums[i-k]; + + + if left_half.contains_key(&num_to_remove) { + Self::decrement_for_key(&mut left_half, num_to_remove); + + *(right_half.entry(num_to_add).or_insert(0))+=1; + let right_min : i32 = *right_half.iter().next().unwrap().0; + Self::decrement_for_key(&mut right_half, right_min); + + *(left_half.entry(right_min).or_insert(0))+=1; + } else if right_half.contains_key(&num_to_remove) { + Self::decrement_for_key(&mut right_half, num_to_remove); + + *(left_half.entry(num_to_add).or_insert(0))+=1; + let left_max : i32 = *left_half.iter().next_back().unwrap().0; + Self::decrement_for_key(&mut left_half, left_max); + + *(right_half.entry(left_max).or_insert(0))+=1; + } else { + panic!("Fail to find num={} to remove at left_half={:?}, and right_half={:?}", num_to_remove, left_half, right_half); + } + + result.push(Self::median(&left_half, &right_half, k)); + + } + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_480() { + assert_eq!(Solution::median_sliding_window(vec![1,3,-1,-3,5,3,6,7], 3), vec![1.0,-1.0,-1.0,3.0,5.0,6.0]); + + assert_eq!(Solution::median_sliding_window(vec![1,4,2,3], 4),vec![2.5] ); + assert_eq!(Solution::median_sliding_window(vec![2147483647,2147483647] ,2),vec![2147483647.0]); + + assert_eq!(Solution::median_sliding_window(vec![-2147483648,-2147483648,2147483647,-2147483648,-2147483648,-2147483648,2147483647,2147483647,2147483647,2147483647,-2147483648,2147483647,-2147483648] + ,1), vec![-2147483648,-2147483648,2147483647,-2147483648,-2147483648,-2147483648,2147483647,2147483647,2147483647,2147483647,-2147483648,2147483647,-2147483648].iter().map(|x|{*x as f64}).collect::>()); + + } +} diff --git a/src/problem/p0483_smallest_good_base.rs b/src/problem/p0483_smallest_good_base.rs new file mode 100644 index 00000000..7e20582c --- /dev/null +++ b/src/problem/p0483_smallest_good_base.rs @@ -0,0 +1,67 @@ +/** + * [483] Smallest Good Base + * + * Given an integer n represented as a string, return the smallest good base of n. + * We call k >= 2 a good base of n, if all digits of n base k are 1's. + * + * Example 1: + * + * Input: n = "13" + * Output: "3" + * Explanation: 13 base 3 is 111. + * + * Example 2: + * + * Input: n = "4681" + * Output: "8" + * Explanation: 4681 base 8 is 11111. + * + * Example 3: + * + * Input: n = "1000000000000000000" + * Output: "999999999999999999" + * Explanation: 1000000000000000000 base 999999999999999999 is 11. + * + * + * Constraints: + * + * n is an integer in the range [3, 10^18]. + * n does not contain any leading zeros. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/smallest-good-base/ +// discuss: https://leetcode.com/problems/smallest-good-base/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn smallest_good_base(n: String) -> String { + // assume the base is k and the number of digits is m. + let n : u128 = n.parse::().unwrap(); + let max_m : u128 = (n as f64).log(2.0f64) as u128; + for m in (1..=max_m).rev() { + let k : f64 = (n as f64).powf(1f64 / (m as f64)); + let k : u128 = k.floor() as u128; + if (k.pow(m as u32 +1)-1)/(k-1) == n && (k.pow(m as u32 +1)-1) % (k-1)==0 { + return k.to_string(); + } + } + (n-1).to_string() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_483() { + assert_eq!(Solution::smallest_good_base("13".to_owned()), "3".to_owned()); + assert_eq!(Solution::smallest_good_base("4681".to_owned()), "8".to_owned()); + assert_eq!(Solution::smallest_good_base("1000000000000000000".to_owned()), "999999999999999999".to_owned()); + } +} diff --git a/src/problem/p0488_zuma_game.rs b/src/problem/p0488_zuma_game.rs new file mode 100644 index 00000000..2420d65a --- /dev/null +++ b/src/problem/p0488_zuma_game.rs @@ -0,0 +1,175 @@ +/** + * [488] Zuma Game + * + * Think about Zuma Game. You have a row of balls on the table, colored red(R), yellow(Y), blue(B), green(G), and white(W). You also have several balls in your hand. + * Each time, you may choose a ball in your hand, and insert it into the row (including the leftmost place and rightmost place). Then, if there is a group of 3 or more balls in the same color touching, remove these balls. Keep doing this until no more balls can be removed. + * Find the minimal balls you have to insert to remove all the balls on the table. If you cannot remove all the balls, output -1. + * + * Example 1: + * + * Input: board = "WRRBBW", hand = "RB" + * Output: -1 + * Explanation: WRRBBW -> WRR[R]BBW -> WBBW -> WBB[B]W -> WW + * + * Example 2: + * + * Input: board = "WWRRBBWW", hand = "WRBRW" + * Output: 2 + * Explanation: WWRRBBWW -> WWRR[R]BBWW -> WWBBWW -> WWBB[B]WW -> WWWW -> empty + * + * Example 3: + * + * Input: board = "G", hand = "GGGGG" + * Output: 2 + * Explanation: G -> G[G] -> GG[G] -> empty + * + * Example 4: + * + * Input: board = "RBYYBBRRB", hand = "YRBGB" + * Output: 3 + * Explanation: RBYYBBRRB -> RBYY[Y]BBRRB -> RBBBRRB -> RRRB -> B -> B[B] -> BB[B] -> empty + * + * + * Constraints: + * + * You may assume that the initial row of balls on the table won’t have any 3 or more consecutive balls with the same color. + * 1 <= board.length <= 16 + * 1 <= hand.length <= 5 + * Both input strings will be non-empty and only contain characters 'R','Y','B','G','W'. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/zuma-game/ +// discuss: https://leetcode.com/problems/zuma-game/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn update(board : &Vec) -> Vec { + // recursively remove a consecutive of three + let mut prev_char : char = ' ';// any char not exists + let mut prev_len : usize = 0; + // println!("board={:?}", board); + for i in 0..board.len() { + + if board[i] == prev_char { + prev_len+=1; + } else { + if prev_len >= 3 { + let streak_start_pos : usize = i - prev_len; + // println!("start_pos={}, prev_len={}, i={}", streak_start_pos, prev_len, i); + let new_board : Vec = board.iter().enumerate().filter(|&(ii, _)| ii < streak_start_pos || ii >= i).map(|(_, v)| v).cloned().collect(); + + // let mut new_board : Vec = board.iter().take(streak_start_pos).skip(prev_len).take(board.len()).cloned().collect(); + return Self::update(&new_board); + } + + prev_char = board[i]; + prev_len = 1; + } + } + + if prev_len >= 3 { + let i = board.len(); + let streak_start_pos : usize = board.len() - prev_len; + // println!("start_pos={}, prev_len={}, i={}", streak_start_pos, prev_len, board.len()); + let new_board : Vec = board.iter().enumerate().filter(|&(ii, _)| ii < streak_start_pos || ii >= i).map(|(_, v)| v).cloned().collect(); + return Self::update(&new_board); + } + board.clone() + } + + pub fn dfs(board : &Vec, hand : &mut HashMap, level : usize, cache : &mut HashMap) -> i32 { + let mut key : String = board.iter().collect::(); + key.push('_'); + for (&k, &v) in hand.iter() { + key.push(k); + key.push_str(&v.to_string()); + } + if let Some(&cached) = cache.get(&key) { + return cached; + } + + let pad : String = (0..level).map(|_|{" "}).collect(); + // println!("{}board={},hand={:?}", pad, board.iter().collect::(), hand); + if board.len() == 0 { return 0i32; } + + let mut result : i32 = -1; + let mut optimal_pos : usize = 100000; + let mut optimal_new_board_before : String = "".to_owned(); + let mut optimal_new_board : String = "".to_owned(); + let mut optimal_char : char = ' '; + for insert_pos in 0..=board.len() { + let hand_chars : Vec = hand.keys().cloned().collect(); + for &hand_char in hand_chars.iter() { + if hand[&hand_char] == 0 { continue; } + *hand.get_mut(&hand_char).unwrap()-=1; + let mut new_board_before : Vec = board.iter().take(insert_pos).cloned().collect(); + new_board_before.push(hand_char); + new_board_before.extend(board.iter().skip(insert_pos).cloned().collect::>()); + + let new_board : Vec = Self::update(&new_board_before); + let next_result : i32 = Self::dfs(&new_board, hand, level+1, cache); + if next_result != -1 { + if result == -1 { + result = 1 + next_result; + optimal_pos = insert_pos; + optimal_char = hand_char; + optimal_new_board_before = new_board_before.iter().cloned().collect(); + optimal_new_board = new_board.iter().cloned().collect(); + + } else if 1 + next_result < result { + result = 1 + next_result; + + optimal_pos = insert_pos; + optimal_char = hand_char; + optimal_new_board = new_board.iter().cloned().collect(); + optimal_new_board_before = new_board_before.iter().cloned().collect(); + } + } + *hand.get_mut(&hand_char).unwrap()+=1; + } + } + // if result != -1 { + // println!(""); + // println!("{}OPTIMAL: pos={}, char={}, new_board={}, new_board_before={}",pad, optimal_pos, optimal_char, optimal_new_board, optimal_new_board_before); + // println!("{}r={}, board={}, hand={:?}",pad, result, board.iter().collect::(), hand); + // } + cache.insert(key, result); + result + } + + pub fn find_min_step(board: String, hand: String) -> i32 { + let board : Vec = board.chars().collect(); + let mut hand2 : HashMap = HashMap::new(); + let mut cache : HashMap = HashMap::new(); + + for c in hand.chars() { + *hand2.entry(c).or_insert(0usize)+=1; + } + Self::dfs(&board, &mut hand2, 0, &mut cache) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_488() { + assert_eq!(Solution::update(&"RBYYBBRRRBY".to_owned().chars().collect::>()), "RB".to_owned().chars().collect::>()); + assert_eq!(Solution::update(&"WRRBBBW".to_owned().chars().collect::>()), "WRRW".to_owned().chars().collect::>()); + assert_eq!(Solution::update(&"WRRRBBBW".to_owned().chars().collect::>()), "WW".to_owned().chars().collect::>()); + assert_eq!(Solution::update(&"WWRRRBBBW".to_owned().chars().collect::>()), "".to_owned().chars().collect::>()); + assert_eq!(Solution::update(&"WRRBBW".to_owned().chars().collect::>()), "WRRBBW".to_owned().chars().collect::>()); + + assert_eq!(Solution::find_min_step("WRRBBW".to_owned(), "RB".to_owned()), -1); + assert_eq!(Solution::find_min_step("WWRRBBWW".to_owned(), "WRBRW".to_owned()), 2); + assert_eq!(Solution::find_min_step("G".to_owned(), "GGGGG".to_owned()), 2); + + assert_eq!(Solution::find_min_step("RBYYBBRRB".to_owned(), "YRBGB".to_owned()), 3); + } +} diff --git a/src/problem/p0493_reverse_pairs.rs b/src/problem/p0493_reverse_pairs.rs new file mode 100644 index 00000000..a0ebe296 --- /dev/null +++ b/src/problem/p0493_reverse_pairs.rs @@ -0,0 +1,92 @@ +/** + * [493] Reverse Pairs + * + * Given an integer array nums, return the number of reverse pairs in the array. + * A reverse pair is a pair (i, j) where 0 <= i < j < nums.length and nums[i] > 2 * nums[j]. + * + * Example 1: + * Input: nums = [1,3,2,3,1] + * Output: 2 + * Example 2: + * Input: nums = [2,4,3,5,1] + * Output: 3 + * + * Constraints: + * + * 1 <= nums.length <= 5 * 10^4 + * -2^31 <= nums[i] <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/reverse-pairs/ +// discuss: https://leetcode.com/problems/reverse-pairs/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn first_greater(sorted : &Vec, target : i64) -> i64 { + let mut low : i64 = 0; + let mut high : i64 = sorted.len() as i64 - 1; + while low <= high { + let mid : usize = ((low + high) / 2 ) as usize; + if sorted[mid] > target { + if mid == 0 || !(sorted[mid-1] > target) { + return mid as i64; + } else { + high = mid as i64 - 1; + } + } else { + low = mid as i64 + 1; + } + } + sorted.len() as i64 + } + + pub fn count_while_merge_sort(mut nums : Vec, count : &mut i64) -> Vec { + if nums.len() < 2 { return nums } + let mid : usize = nums.len() / 2; + let right_half : Vec = nums.split_off(mid); + let left_half : Vec = nums; + + let mut left_half : Vec = Self::count_while_merge_sort(left_half, count); + let mut right_half : Vec = Self::count_while_merge_sort(right_half, count); + // println!("left={:?}, right={:?}", left_half, right_half); + for &right_num in right_half.iter() { + let first_gt_pos : i64 = Self::first_greater(&left_half, 2*right_num); + // println!("first_gt_pos={}, right_num={}", first_gt_pos, right_num); + *count += left_half.len() as i64 - first_gt_pos; + } + + + let mut reverse_sorted : Vec = vec![]; + while left_half.len() != 0 || right_half.len() != 0 { + if right_half.len() == 0 || left_half.len() != 0 && *left_half.last().unwrap() > *right_half.last().unwrap() { + reverse_sorted.push(left_half.pop().unwrap()); + } else { + reverse_sorted.push(right_half.pop().unwrap()); + } + } + reverse_sorted.into_iter().rev().collect() + } + + pub fn reverse_pairs(nums: Vec) -> i32 { + let mut count : i64 = 0; + let nums : Vec = nums.iter().map(|&x|{x as i64}).collect(); + Self::count_while_merge_sort(nums, &mut count); + count as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_493() { + assert_eq!(Solution::reverse_pairs(vec![1,3,2,3,1]), 2); + assert_eq!(Solution::reverse_pairs(vec![2,4,3,5,1]), 3); + } +} diff --git a/src/problem/p0494_target_sum.rs b/src/problem/p0494_target_sum.rs new file mode 100644 index 00000000..9cbc050d --- /dev/null +++ b/src/problem/p0494_target_sum.rs @@ -0,0 +1,117 @@ +use std::collections::HashMap; + +/** + * [494] Target Sum + * + * You are given a list of non-negative integers, a1, a2, ..., an, and a target, S. Now you have 2 symbols + and -. For each integer, you should choose one from + and - as its new symbol. + * Find out how many ways to assign symbols to make sum of integers equal to target S. + * Example 1: + * + * Input: nums is [1, 1, 1, 1, 1], S is 3. + * Output: 5 + * Explanation: + * -1+1+1+1+1 = 3 + * +1-1+1+1+1 = 3 + * +1+1-1+1+1 = 3 + * +1+1+1-1+1 = 3 + * +1+1+1+1-1 = 3 + * There are 5 ways to assign symbols to make the sum of nums be target 3. + * + * + * Constraints: + * + * The length of the given array is positive and will not exceed 20. + * The sum of elements in the given array will not exceed 1000. + * Your output answer is guaranteed to be fitted in a 32-bit integer. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/target-sum/ +// discuss: https://leetcode.com/problems/target-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn nums_subsets_sum(nums: Vec, target: i32) -> usize { + let target = target as usize; + let mut result = vec![0; target + 1]; + result[0] = 1; + + for &num in &nums { + for s in (num as usize ..=target).rev() { + let num = num as usize; + result[s] = result[s] + result[s-num]; + } + } + + result[target] + } + + pub fn find_target_sum_ways(nums: Vec, s: i32) -> i32 { + let mut sum = 0; + for &num in &nums { + sum += num; + } + + if sum < s || (s + sum) % 2 == 1 { + 0 + } else { + Self::nums_subsets_sum(nums, (s+sum)/2) as i32 + } + + } + + + // pub fn find_target_sum_ways_2(nums: Vec, s: i32) -> i32 { + // let mut sum = 0; + // for &num in &nums { + // sum += num; + // } + + // if s < -sum || sum < s { + // return 0; + // } + // // ways[k]{s->n} denotes that there are n ways to sum up to s with the first k coins. + // let mut ways: Vec> = vec![HashMap::new(); nums.len()+1]; + + // ways[0].insert(0, 1); // there is a way to sum to 0 without any elements. + // for (i, &num) in nums.iter().enumerate() { + // let i = i + 1; + // for j in -sum..=sum { + // let plus_sum = j - num; // assume a plus sign before num to attain j. + + // let mut plus_ways = 0usize; + // if let Some(&p) = ways[i-1].get(&plus_sum) { + // plus_ways = p; + // } + + + // let minus_sum = j + num; // assume a minus sign before num to attain j. + + // let mut minus_ways = 0usize; + // if let Some(&p) = ways[i-1].get(&minus_sum) { + // minus_ways = p; + // } + // ways[i].insert(j, minus_ways + plus_ways); + // } + // } + // if let Some(&r) = ways[nums.len()].get(&s) { + // r as i32 + // } else { + // 0 + // } + // } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_494() { + assert_eq!(Solution::find_target_sum_ways(vec![1, 1, 1, 1, 1], 3), 5); + } +} diff --git a/src/problem/p0496_next_greater_element_i.rs b/src/problem/p0496_next_greater_element_i.rs new file mode 100644 index 00000000..208ad8b3 --- /dev/null +++ b/src/problem/p0496_next_greater_element_i.rs @@ -0,0 +1,82 @@ +/** + * [496] Next Greater Element I + * + * You are given two integer arrays nums1 and nums2 both of unique elements, where nums1 is a subset of nums2. + * Find all the next greater numbers for nums1's elements in the corresponding places of nums2. + * The Next Greater Number of a number x in nums1 is the first greater number to its right in nums2. If it does not exist, return -1 for this number. + * + * Example 1: + * + * Input: nums1 = [4,1,2], nums2 = [1,3,4,2] + * Output: [-1,3,-1] + * Explanation: + * For number 4 in the first array, you cannot find the next greater number for it in the second array, so output -1. + * For number 1 in the first array, the next greater number for it in the second array is 3. + * For number 2 in the first array, there is no next greater number for it in the second array, so output -1. + * Example 2: + * + * Input: nums1 = [2,4], nums2 = [1,2,3,4] + * Output: [3,-1] + * Explanation: + * For number 2 in the first array, the next greater number for it in the second array is 3. + * For number 4 in the first array, there is no next greater number for it in the second array, so output -1. + * + * Constraints: + * + * 1 <= nums1.length <= nums2.length <= 1000 + * 0 <= nums1[i], nums2[i] <= 10^4 + * All integers in nums1 and nums2 are unique. + * All the integers of nums1 also appear in nums2. + * + * + * Follow up: Could you find an O(nums1.length + nums2.length) solution? + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/next-greater-element-i/ +// discuss: https://leetcode.com/problems/next-greater-element-i/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::collections::HashMap; +impl Solution { + pub fn next_greater_element(nums1: Vec, mut nums2: Vec) -> Vec { + let mut all_result = HashMap::new(); + + let mut stack = vec![]; + nums2.reverse(); + for num in nums2 { + while let Some(&last) = stack.last() { + if last < num { + stack.pop(); + } else { + break; + } + } + if let Some(&last) = stack.last() { + all_result.insert(num, last); + } else { + all_result.insert(num, -1i32); + } + stack.push(num); + } + + let mut result = vec![]; + for num in nums1 { + result.push(all_result[&num]); + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_496() { + + } +} diff --git a/src/problem/p0498_diagonal_traverse.rs b/src/problem/p0498_diagonal_traverse.rs new file mode 100644 index 00000000..4e43eeb1 --- /dev/null +++ b/src/problem/p0498_diagonal_traverse.rs @@ -0,0 +1,87 @@ +/** + * [498] Diagonal Traverse + * + * Given an m x n matrix mat, return an array of all the elements of the array in a diagonal order. + * + * Example 1: + * + * Input: mat = [[1,2,3],[4,5,6],[7,8,9]] + * Output: [1,2,4,7,5,3,6,8,9] + * + * Example 2: + * + * Input: mat = [[1,2],[3,4]] + * Output: [1,2,3,4] + * + * + * Constraints: + * + * m == mat.length + * n == mat[i].length + * 1 <= m, n <= 10^4 + * 1 <= m * n <= 10^4 + * -10^5 <= mat[i][j] <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/diagonal-traverse/ +// discuss: https://leetcode.com/problems/diagonal-traverse/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn valid(i : i32, j : i32, row_count : i32, col_count : i32) -> bool { + 0 <= i && i < row_count && 0 <= j && j < col_count + } + pub fn find_diagonal_order(mat: Vec>) -> Vec { + let mut result = vec![]; + let row_count : i32 = mat.len() as i32; + let col_count : i32 = mat[0].len() as i32; + let mut i : i32 = 0; + let mut j : i32 = 0; + loop { + while !Self::valid(i, j, row_count, col_count) { + i-=1; + j+=1; + } + while Self::valid(i, j, row_count, col_count) { + result.push(mat[i as usize][j as usize]); + i-=1; + j+=1; + } + j+=1; + if result.len() as i32 == row_count * col_count { + break; + } + + while !Self::valid(i, j, row_count, col_count) { + i+=1; + j-=1; + } + while Self::valid(i, j, row_count, col_count) { + result.push(mat[i as usize][j as usize]); + i+=1; + j-=1; + } + j+=1; + if result.len() as i32 == row_count * col_count { + break; + } + + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_498() { + assert_eq!(Solution::find_diagonal_order(vec![vec![1,2,3],vec![4,5,6],vec![7,8,9]]), vec![1,2,4,7,5,3,6,8,9]); + } +} diff --git a/src/problem/p0502_ipo.rs b/src/problem/p0502_ipo.rs new file mode 100644 index 00000000..3b11270f --- /dev/null +++ b/src/problem/p0502_ipo.rs @@ -0,0 +1,121 @@ +/** + * [502] IPO + * + * Suppose LeetCode will start its IPO soon. In order to sell a good price of its shares to Venture Capital, LeetCode would like to work on some projects to increase its capital before the IPO. Since it has limited resources, it can only finish at most k distinct projects before the IPO. Help LeetCode design the best way to maximize its total capital after finishing at most k distinct projects. + * You are given n projects where the i^th project has a pure profit profits[i] and a minimum capital of capital[i] is needed to start it. + * Initially, you have w capital. When you finish a project, you will obtain its pure profit and the profit will be added to your total capital. + * Pick a list of at most k distinct projects from given projects to maximize your final capital, and return the final maximized capital. + * The answer is guaranteed to fit in a 32-bit signed integer. + * + * Example 1: + * + * Input: k = 2, w = 0, profits = [1,2,3], capital = [0,1,1] + * Output: 4 + * Explanation: Since your initial capital is 0, you can only start the project indexed 0. + * After finishing it you will obtain profit 1 and your capital becomes 1. + * With capital 1, you can either start the project indexed 1 or the project indexed 2. + * Since you can choose at most 2 projects, you need to finish the project indexed 2 to get the maximum capital. + * Therefore, output the final maximized capital, which is 0 + 1 + 3 = 4. + * + * Example 2: + * + * Input: k = 3, w = 0, profits = [1,2,3], capital = [0,1,2] + * Output: 6 + * + * + * Constraints: + * + * 1 <= k <= 10^5 + * 0 <= w <= 10^9 + * n == profits.length + * n == capital.length + * 1 <= n <= 10^5 + * 0 <= profits[i] <= 10^4 + * 0 <= capital[i] <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/ipo/ +// discuss: https://leetcode.com/problems/ipo/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::BTreeMap; +impl Solution { + pub fn push(heap : &mut BTreeMap>, key : i32, pos : usize){ + heap.entry(key).or_insert(vec![]).push(pos); + } + + pub fn min(heap : &BTreeMap>) -> Option<(i32, usize)> { + if let Some((&max_key, positions)) = heap.iter().next() { + Some((max_key, *positions.last().unwrap())) + } else { + None + } + + } + + pub fn pop_max(heap : &mut BTreeMap>) -> Option<(i32, usize)> { + if let Some((&max_key, _)) = heap.iter().next_back() { + let pos : usize = heap.get_mut(&max_key).unwrap().pop().unwrap(); + if heap[&max_key].len() == 0 {heap.remove(&max_key);} + Some((max_key, pos)) + } else { + None + } + } + + pub fn pop_min(heap : &mut BTreeMap>) -> Option<(i32, usize)> { + if let Some((&min_key, _)) = heap.iter().next() { + let pos : usize = heap.get_mut(&min_key).unwrap().pop().unwrap(); + if heap[&min_key].len() == 0 {heap.remove(&min_key);} + Some((min_key, pos)) + } else { + None + } + } + + + pub fn find_maximized_capital(mut k: i32, mut w: i32, profits: Vec, capital: Vec) -> i32 { + + let mut in_budget_prices: BTreeMap> = BTreeMap::new(); + let mut out_budget_capitals : BTreeMap> = BTreeMap::new(); + + for (i, &c) in capital.iter().enumerate() { + Self::push(&mut out_budget_capitals, c, i); + } + + while k > 0 { + while let Some((capital, i)) = Self::min(&out_budget_capitals) { + if capital <= w { + Self::pop_min(&mut out_budget_capitals); + Self::push(&mut in_budget_prices, profits[i], i); + } else { + break; + } + } + // println!("in_budget_prices={:?}, out_budget_capitals={:?}", in_budget_prices, out_budget_capitals); + + if let Some((profit, i)) = Self::pop_max(&mut in_budget_prices) { + w += profit; + k-=1; + } else { + break + } + } + w + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_502() { + assert_eq!(Solution::find_maximized_capital(2, 0, vec![1,2,3], vec![0,1,1]), 4); + assert_eq!(Solution::find_maximized_capital(3, 0, vec![1,2,3], vec![0,1,2]), 6); + } +} diff --git a/src/problem/p0503_next_greater_element_ii.rs b/src/problem/p0503_next_greater_element_ii.rs new file mode 100644 index 00000000..632690b8 --- /dev/null +++ b/src/problem/p0503_next_greater_element_ii.rs @@ -0,0 +1,78 @@ +/** + * [503] Next Greater Element II + * + * + * Given a circular array (the next element of the last element is the first element of the array), print the Next Greater Number for every element. The Next Greater Number of a number x is the first greater number to its traversing-order next in the array, which means you could search circularly to find its next greater number. If it doesn't exist, output -1 for this number. + * + * + * Example 1:
+ * + * Input: [1,2,1] + * Output: [2,-1,2] + * Explanation: The first 1's next greater number is 2;
The number 2 can't find next greater number;
The second 1's next greater number needs to search circularly, which is also 2. + * + * + * + * Note: + * The length of given array won't exceed 10000. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/next-greater-element-ii/ +// discuss: https://leetcode.com/problems/next-greater-element-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn next_greater_elements(nums: Vec) -> Vec { + // Locate the max_num and its index. + let (mut max_id, mut max_num) : (usize, i32) = (0, -10000000); + for (idx, &num) in nums.iter().enumerate() { + if max_num < num { + max_id = idx; + max_num = num; + } + } + + // println!("max_id: {}, max_num: {}", max_id, max_num); + // From the max num and circularly iterate to the left + // Update the result stack. + let size = nums.len(); + let mut result = vec![-1; size]; + let mut stack = vec![]; + for i in 0..size { + let idx = (max_id+size-i) % size; + let num = nums[idx]; + while let Some(&last) = stack.last() { + if last <= num { + stack.pop(); + } else { + break; + } + } + if let Some(&last) = stack.last() { + result[idx] = last; + } + stack.push(num); + println!("idx: {}, num: {}, stack: {:?}", idx, num, stack); + } + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_503() { + assert_eq!( + Solution::next_greater_elements(vec![1, 2, 1]), + vec![2, -1, 2] + ); + } +} diff --git a/src/problem/p0514_freedom_trail.rs b/src/problem/p0514_freedom_trail.rs new file mode 100644 index 00000000..c9477c6f --- /dev/null +++ b/src/problem/p0514_freedom_trail.rs @@ -0,0 +1,90 @@ +/** + * [514] Freedom Trail + * + * In the video game Fallout 4, the quest "Road to Freedom" requires players to reach a metal dial called the "Freedom Trail Ring" and use the dial to spell a specific keyword to open the door. + * Given a string ring that represents the code engraved on the outer ring and another string key that represents the keyword that needs to be spelled, return the minimum number of steps to spell all the characters in the keyword. + * Initially, the first character of the ring is aligned at the "12:00" direction. You should spell all the characters in key one by one by rotating ring clockwise or anticlockwise to make each character of the string key aligned at the "12:00" direction and then by pressing the center button. + * At the stage of rotating the ring to spell the key character key[i]: + *
    + * You can rotate the ring clockwise or anticlockwise by one place, which counts as one step. The final purpose of the rotation is to align one of ring's characters at the "12:00" direction, where this character must equal key[i]. + * If the character key[i] has been aligned at the "12:00" direction, press the center button to spell, which also counts as one step. After the pressing, you could begin to spell the next character in the key (next stage). Otherwise, you have finished all the spelling. + *
+ * + * Example 1: + * + * Input: ring = "godding", key = "gd" + * Output: 4 + * Explanation: + * For the first key character 'g', since it is already in place, we just need 1 step to spell this character. + * For the second key character 'd', we need to rotate the ring "godding" anticlockwise by two steps to make it become "ddinggo". + * Also, we need 1 more step for spelling. + * So the final output is 4. + * + * Example 2: + * + * Input: ring = "godding", key = "godding" + * Output: 13 + * + * + * Constraints: + * + * 1 <= ring.length, key.length <= 100 + * ring and key consist of only lower case English letters. + * It is guaranteed that key could always be spelled by rotating ring. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/freedom-trail/ +// discuss: https://leetcode.com/problems/freedom-trail/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn solve(ring : &Vec, key : &Vec, ring_pos : usize, key_pos : usize, cache : &mut HashMap<(usize, usize), i32>) -> i32 { + if key_pos == key.len() { + return 0; + } + if let Some(&cached) = cache.get(&(ring_pos, key_pos)) { + return cached + } + + let ring_len : usize = ring.len(); + let mut min_total_step : i32 = 10000000; + for i in 0..ring_len { + if ring[i] == key[key_pos] { + let clockwise_rotation : usize = (i + ring_len - ring_pos) % ring_len; + let anticlockwise_rotation : usize = (ring_pos + ring_len - i) % ring_len; + // println!("\ti={},c_rotation={}, anti_rotation={}", i, clockwise_rotation, anticlockwise_rotation); + let this_step : i32 = 1 + std::cmp::min(clockwise_rotation, anticlockwise_rotation) as i32; + + let total_step : i32 = this_step + Self::solve(ring, key, i, key_pos+1, cache); + min_total_step = std::cmp::min(min_total_step, total_step); + } + } + // println!("ring_pos={}, key_pos={}, min_total_step={}", ring_pos, key_pos, min_total_step); + cache.insert((ring_pos, key_pos), min_total_step); + min_total_step + } + + pub fn find_rotate_steps(ring: String, key: String) -> i32 { + let mut cache : HashMap<(usize, usize), i32> = HashMap::new(); + let ring : Vec = ring.chars().collect(); + let key : Vec = key.chars().collect(); + + Self::solve(&ring, &key, 0usize, 0usize, &mut cache) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_514() { + assert_eq!(Solution::find_rotate_steps("godding".to_owned(), "gd".to_owned()), 4); + assert_eq!(Solution::find_rotate_steps("godding".to_owned(), "godding".to_owned()), 13); + } +} diff --git a/src/problem/p0517_super_washing_machines.rs b/src/problem/p0517_super_washing_machines.rs new file mode 100644 index 00000000..c8897613 --- /dev/null +++ b/src/problem/p0517_super_washing_machines.rs @@ -0,0 +1,76 @@ +/** + * [517] Super Washing Machines + * + * You have n super washing machines on a line. Initially, each washing machine has some dresses or is empty. + * For each move, you could choose any m (1 <= m <= n) washing machines, and pass one dress of each washing machine to one of its adjacent washing machines at the same time. + * Given an integer array machines representing the number of dresses in each washing machine from left to right on the line, return the minimum number of moves to make all the washing machines have the same number of dresses. If it is not possible to do it, return -1. + * + * Example 1: + * + * Input: machines = [1,0,5] + * Output: 3 + * Explanation: + * 1st move: 1 0 <-- 5 => 1 1 4 + * 2nd move: 1 <-- 1 <-- 4 => 2 1 3 + * 3rd move: 2 1 <-- 3 => 2 2 2 + * + * Example 2: + * + * Input: machines = [0,3,0] + * Output: 2 + * Explanation: + * 1st move: 0 <-- 3 0 => 1 2 0 + * 2nd move: 1 2 --> 0 => 1 1 1 + * + * Example 3: + * + * Input: machines = [0,2,0] + * Output: -1 + * Explanation: + * It's impossible to make all three washing machines have the same number of dresses. + * + * + * Constraints: + * + * n == machines.length + * 1 <= n <= 10^4 + * 0 <= machines[i] <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/super-washing-machines/ +// discuss: https://leetcode.com/problems/super-washing-machines/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_min_moves(machines: Vec) -> i32 { + let sum : i32 = machines.iter().sum::(); + let count : i32 = machines.len() as i32; + + if sum % count != 0 { return -1; } + let avg : i32 = sum / count; + + let mut extra : i32 = 0; + let mut result : i32 = 0; + for &machine in machines.iter() { + extra += machine - avg; + result = *[result, machine - avg, extra.abs()].iter().max().unwrap(); + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_517() { + assert_eq!(Solution::find_min_moves(vec![1,0,5]), 3); + assert_eq!(Solution::find_min_moves(vec![0,3,0]), 2); + } +} diff --git a/src/problem/p0518_coin_change_ii.rs b/src/problem/p0518_coin_change_ii.rs new file mode 100644 index 00000000..0ac16e02 --- /dev/null +++ b/src/problem/p0518_coin_change_ii.rs @@ -0,0 +1,110 @@ +/** + * [518] Coin Change 2 + * + * You are given coins of different denominations and a total amount of money. Write a function to compute the number of combinations that make up that amount. You may assume that you have infinite number of each kind of coin. + * + * + * + * + * + * + * Example 1: + * + * + * Input: amount = 5, coins = [1, 2, 5] + * Output: 4 + * Explanation: there are four ways to make up the amount: + * 5=5 + * 5=2+2+1 + * 5=2+1+1+1 + * 5=1+1+1+1+1 + * + * + * Example 2: + * + * + * Input: amount = 3, coins = [2] + * Output: 0 + * Explanation: the amount of 3 cannot be made up just with coins of 2. + * + * + * Example 3: + * + * + * Input: amount = 10, coins = [10] + * Output: 1 + * + * + * + * + * Note: + * + * You can assume that + * + * + * 0 <= amount <= 5000 + * 1 <= coin <= 5000 + * the number of coins is less than 500 + * the answer is guaranteed to fit into signed 32-bit integer + * + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/coin-change-2/ +// discuss: https://leetcode.com/problems/coin-change-2/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn change(amount: i32, coins: Vec) -> i32 { + + let amount : usize = amount as usize; + let mut result : Vec> = vec![vec![0;amount+1];coins.len()+1]; + // result[i][j] represent the ways to make amount i with the first j coins. + + result[0][0] = 1; + for j in 1..=amount { + // no way to make up any amount without coins. + result[0][j] = 0; + } + for i in 1..=coins.len() { + result[i][0] = 1; + for j in 1..=amount { + //make up only using the first i-1 coints. + result[i][j] = result[i-1][j]; + let this_coin : usize = coins[i-1] as usize; + if this_coin <= j { + //make up only using at least one coin[i] + result[i][j] += result[i][j-this_coin]; + } + } + } + result[coins.len()][amount] + } + + pub fn change_1d(amount: i32, coins: Vec) -> i32 { + let mut amount = amount as usize; + let mut result = vec![0;amount+1]; + result[0] = 1; + for i in 1..=coins.len() { + let this_coin = coins[i-1] as usize; + for j in this_coin..=amount { + result[j] += result[j-this_coin]; + } + } + result[amount] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_518() { + assert_eq!(Solution::change(5, vec![1, 2, 5]), 4); + } +} diff --git a/src/problem/p0546_remove_boxes.rs b/src/problem/p0546_remove_boxes.rs new file mode 100644 index 00000000..ad4be829 --- /dev/null +++ b/src/problem/p0546_remove_boxes.rs @@ -0,0 +1,81 @@ +/** + * [546] Remove Boxes + * + * You are given several boxes with different colors represented by different positive numbers. + * You may experience several rounds to remove boxes until there is no box left. Each time you can choose some continuous boxes with the same color (i.e., composed of k boxes, k >= 1), remove them and get k * k points. + * Return the maximum points you can get. + * + * Example 1: + * + * Input: boxes = [1,3,2,2,2,3,4,3,1] + * Output: 23 + * Explanation: + * [1, 3, 2, 2, 2, 3, 4, 3, 1] + * ----> [1, 3, 3, 4, 3, 1] (3*3=9 points) + * ----> [1, 3, 3, 3, 1] (1*1=1 points) + * ----> [1, 1] (3*3=9 points) + * ----> [] (2*2=4 points) + * + * Example 2: + * + * Input: boxes = [1,1,1] + * Output: 9 + * + * Example 3: + * + * Input: boxes = [1] + * Output: 1 + * + * + * Constraints: + * + * 1 <= boxes.length <= 100 + * 1 <= boxes[i] <= 100 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/remove-boxes/ +// discuss: https://leetcode.com/problems/remove-boxes/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + // prev_count counts the previous consecutive occurrence of boxes[left] + // left and right are inclusive + pub fn compute(boxes : &Vec, left : usize, right : usize, prev_count : usize, cache : &mut HashMap<(usize, usize, usize), i32>) -> i32 { + if left > right { return 0; } + if let Some(&cached) = cache.get(&(left, right, prev_count)) { + return cached; + } + let mut cur_max : i32 = prev_count as i32 * prev_count as i32 + Self::compute(boxes, left + 1, right, 1, cache); + + for i in left+1..=right { + if boxes[left] == boxes[i] { + // process [left+1,i-1] so that boxes[left], boxes[i] can be consecutive when processing [i,right]. + let this_max = Self::compute(boxes, left + 1, i - 1, 1, cache) + Self::compute(boxes, i, right, prev_count+1, cache); + cur_max = std::cmp::max(cur_max, this_max); + } + } + cache.insert((left, right, prev_count), cur_max); + cur_max + } + + pub fn remove_boxes(boxes: Vec) -> i32 { + Self::compute(&boxes, 0, boxes.len()-1, 1, &mut HashMap::new()) + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_546() { + assert_eq!(Solution::remove_boxes(vec![1,3,2,2,2,3,4,3,1]), 23); + assert_eq!(Solution::remove_boxes(vec![1,1,1]), 9); + assert_eq!(Solution::remove_boxes(vec![1]), 1); + } +} diff --git a/src/problem/p0547_number_of_provinces.rs b/src/problem/p0547_number_of_provinces.rs new file mode 100644 index 00000000..c3f14b4c --- /dev/null +++ b/src/problem/p0547_number_of_provinces.rs @@ -0,0 +1,198 @@ +/** + * [547] Number of Provinces + * + * There are n cities. Some of them are connected, while some are not. If city a is connected directly with city b, and city b is connected directly with city c, then city a is connected indirectly with city c. + * A province is a group of directly or indirectly connected cities and no other cities outside of the group. + * You are given an n x n matrix isConnected where isConnected[i][j] = 1 if the i^th city and the j^th city are directly connected, and isConnected[i][j] = 0 otherwise. + * Return the total number of provinces. + * + * Example 1: + * + * Input: isConnected = [[1,1,0],[1,1,0],[0,0,1]] + * Output: 2 + * + * Example 2: + * + * Input: isConnected = [[1,0,0],[0,1,0],[0,0,1]] + * Output: 3 + * + * + * Constraints: + * + * 1 <= n <= 200 + * n == isConnected.length + * n == isConnected[i].length + * isConnected[i][j] is 1 or 0. + * isConnected[i][i] == 1 + * isConnected[i][j] == isConnected[j][i] + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/number-of-provinces/ +// discuss: https://leetcode.com/problems/number-of-provinces/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashSet; +use std::{collections::HashMap, hash::Hash}; + +struct UnionFind { + parents: HashMap, + subset_sizes: HashMap, + pub max_subset_size: usize, + pub subset_count: usize, +} + +impl UnionFind { + fn new(elements : HashSet) -> UnionFind { + let mut uf = UnionFind{ + parents: HashMap::new(), + subset_sizes: HashMap::new(), + max_subset_size: 1, + subset_count: elements.len()}; + + for &e in &elements { + uf.parents.insert(e,e); + uf.subset_sizes.insert(e,1); + } + + uf + } + // None if element is not found. + fn find(&self, element : T) -> Option { + if !self.parents.contains_key(&element) { + return None; + } + + let mut root = element; + while root != *self.parents.get(&root).unwrap() { + root = *self.parents.get(&root).unwrap(); + } + Some(root) + } + + fn find_along_compression(&mut self, element : T) -> Option { + if let Some(root) = self.find(element) { + // path compression: redirects each node in the path to the root. + let mut element = element; + while element != *self.parents.get(&element).unwrap() { + let tmp = *self.parents.get(&element).unwrap(); + *self.parents.get_mut(&element).unwrap() = root; + element = tmp; + } + + Some(root) + } else { + None + } + } + + // return whether the union has performed. + fn union(&mut self, e1 : T, e2 : T ) -> bool { + let root1 = self.find_along_compression(e1); + let root2 = self.find_along_compression(e2); + if root1 == root2 || root1.is_none() || root2.is_none() { return false} + let root1= root1.unwrap(); + let root2 = root2.unwrap(); + + let root1_size = *self.subset_sizes.get(&root1).unwrap(); + let root2_size = *self.subset_sizes.get(&root2).unwrap(); + // concat the smaller tress to the larger + if root1_size < root2_size { + *self.parents.get_mut(&root1).unwrap() = root2; + *self.subset_sizes.get_mut(&root2).unwrap() += root1_size; + } else { + *self.parents.get_mut(&root2).unwrap() = root1; + *self.subset_sizes.get_mut(&root1).unwrap() += root2_size; + } + self.max_subset_size = std::cmp::max(self.max_subset_size, root1_size + root2_size); + self.subset_count-=1; + true + } +} + +impl Solution { + pub fn find_circle_num(mut is_connected: Vec>) -> i32 { + let n = is_connected.len(); + let mut roots = vec![0;n]; + for i in 0..n { + roots[i] = i; + } + + loop { + let mut connected_1 = 0usize; + let mut connected_2 = 0usize; + // Find first i is the root. + + let mut found_connected = false; + for i in 0..n { + if roots[i] != i {continue;} // skip non-root + for j in i+1..n { + if is_connected[i][j] == 1 && roots[j] != i { + connected_1 = i; + connected_2 = j; + found_connected = true; + break; + } + } + if found_connected {break;} + } + + if !found_connected {break} + // println!("connected_1={} connected_2={}",connected_1, connected_2); + // merge j's connectivity into i + + for k in 0..n { + is_connected[connected_1][k] |= is_connected[roots[connected_2]][k]; + } + for jj in 0..n { + if roots[jj] == roots[connected_2] { + roots[jj] = connected_1; + } + } + // println!("\troots={:?}", roots); + // println!("\tconnected={:?}", is_connected); + + } + + let mut root_count = 0; + for i in 0..n { + if roots[i] == i {root_count+=1;} + } + root_count + + } + + // pub fn find_circle_num_uf(is_connected: Vec>) -> i32 { + + // let mut elements = HashSet::new(); + // let n = is_connected.len(); + // for i in 0..n { + // elements.insert(i); + // } + // let mut uf = UnionFind::new(elements); + // for i in 0..n { + // for j in 0..n { + // if is_connected[i][j] == 1 { + // uf.union(i, j); + // } + // } + // } + + // uf.subset_count as i32 + // } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_547() { + assert_eq!(Solution::find_circle_num(vec![vec![1,1,0],vec![1,1,0],vec![0,0,1]]), 2); + assert_eq!(Solution::find_circle_num(vec![vec![1,0,0],vec![0,1,0],vec![0,0,1]]), 3); + assert_eq!(Solution::find_circle_num(vec![vec![1,0,0,1],vec![0,1,1,0],vec![0,1,1,1],vec![1,0,1,1]]), 1); + } +} diff --git a/src/problem/p0552_student_attendance_record_ii.rs b/src/problem/p0552_student_attendance_record_ii.rs new file mode 100644 index 00000000..a03c0eba --- /dev/null +++ b/src/problem/p0552_student_attendance_record_ii.rs @@ -0,0 +1,153 @@ +/** + * [552] Student Attendance Record II + * + * An attendance record for a student can be represented as a string where each character signifies whether the student was absent, late, or present on that day. The record only contains the following three characters: + * + * 'A': Absent. + * 'L': Late. + * 'P': Present. + * + * Any student is eligible for an attendance award if they meet both of the following criteria: + * + * The student was absent ('A') for strictly fewer than 2 days total. + * The student was never late ('L') for 3 or more consecutive days. + * + * Given an integer n, return the number of possible attendance records of length n that make a student eligible for an attendance award. The answer may be very large, so return it modulo 10^9 + 7. + * + * Example 1: + * + * Input: n = 2 + * Output: 8 + * Explanation: There are 8 records with length 2 that are eligible for an award: + * "PP", "AP", "PA", "LP", "PL", "AL", "LA", "LL" + * Only "AA" is not eligible because there are 2 absences (there need to be fewer than 2). + * + * Example 2: + * + * Input: n = 1 + * Output: 3 + * + * Example 3: + * + * Input: n = 10101 + * Output: 183236316 + * + * + * Constraints: + * + * 1 <= n <= 10^5 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/student-attendance-record-ii/ +// discuss: https://leetcode.com/problems/student-attendance-record-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +const MODULAR_I64 : i64 = 1000000000+7; +const MODULAR : i32 = 1000000000+7; +impl Solution { + fn acc(n : usize, prev_absence_count : usize, prev_consecutive_late_count : usize, cache : &mut HashMap<(usize, usize, usize), i64>) -> i64 { + if let Some(&cached) = cache.get(&(n, prev_absence_count, prev_consecutive_late_count)) { + return cached; + } + + if prev_absence_count == 2 || prev_consecutive_late_count == 3 { + 0i64 + } else if n == 0 { + 1i64 + } else { + let this_absence_count : i64 = Self::acc(n-1, prev_absence_count+1, 0, cache); + let this_late_count : i64 = Self::acc(n-1, prev_absence_count, prev_consecutive_late_count+1, cache); + let this_presence_count : i64 = Self::acc(n-1, prev_absence_count, 0, cache); + + let sum : i64 = (this_absence_count + this_late_count + this_presence_count) % MODULAR_I64; + cache.insert((n, prev_absence_count, prev_consecutive_late_count), sum); + sum + } + } + + // stack overflow + pub fn check_record_topdown(n: i32) -> i32 { + let n : usize = n as usize; + Self::acc(n, 0, 0, &mut HashMap::new()) as i32 + } + + pub fn check_record(n: i32) -> i32 { + // only one a + let mut a_x_ll : i64 = 0; + let mut a_x_l : i64 = 0; + + // let mut a_x_p : i64 = 0; + // let mut x_a : i64 = 1; + let mut a_x : i64 = 1; // aggregate a_x_p + x_a + + // no a + let mut x_ll : i64 = 0; // 2 trailing l + let mut x_l : i64 = 1; // 1 trailing l + let mut x : i64 = 1; // no trailing l + + let n : usize = n as usize; + for i in 1..n { + let past_a_x_ll = a_x_ll; + let past_a_x_l = a_x_l; + // let past_a_x_p = a_x_p; + // let past_x_a = x_a; + let past_a_x = a_x; + let past_x_ll = x_ll; + let past_x_l = x_l; + let past_x = x; + + a_x_ll = ( + past_a_x_l // append l + ) % MODULAR_I64; + + a_x_l = ( + // past_a_x_p // append l + // + past_x_a // append l + past_a_x // append l + ) % MODULAR_I64; + + a_x = ( + past_a_x_ll // append p + + past_a_x_l // append p + + past_a_x // append p + + past_x_ll // append a + + past_x_l // append a + + past_x // append a + ) + % MODULAR_I64; // append p + + x_ll = ( + past_x_l // append l + ) % MODULAR_I64; + + x_l = ( + past_x // append l + ) % MODULAR_I64; + + x = ( + past_x_ll // append p + + past_x_l // append p + + past_x // append p + ) % MODULAR_I64; + } + // ((a_x_ll + a_x_l + a_x_p + x_ll + x_l + x + x_a) % MODULAR_I64) as i32 + ((a_x_ll + a_x_l + x_ll + x_l + x + a_x) % MODULAR_I64) as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_552() { + assert_eq!(Solution::check_record(2), 8); + assert_eq!(Solution::check_record(1), 3); + assert_eq!(Solution::check_record(10101), 183236316); + } +} diff --git a/src/problem/p0633_sum_of_square_numbers.rs b/src/problem/p0633_sum_of_square_numbers.rs new file mode 100644 index 00000000..9c7ab92a --- /dev/null +++ b/src/problem/p0633_sum_of_square_numbers.rs @@ -0,0 +1,99 @@ +/** + * [633] Sum of Square Numbers + * + * Given a non-negative integer c, decide whether there're two integers a and b such that a^2 + b^2 = c. + * + * Example 1: + * + * Input: c = 5 + * Output: true + * Explanation: 1 * 1 + 2 * 2 = 5 + * + * Example 2: + * + * Input: c = 3 + * Output: false + * + * Example 3: + * + * Input: c = 4 + * Output: true + * + * Example 4: + * + * Input: c = 2 + * Output: true + * + * Example 5: + * + * Input: c = 1 + * Output: true + * + * + * Constraints: + * + * 0 <= c <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/sum-of-square-numbers/ +// discuss: https://leetcode.com/problems/sum-of-square-numbers/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashSet; + +impl Solution { + pub fn judge_square_sum(c: i32) -> bool { + let mut low = 0; + let mut high = (c as f64).sqrt() as i32 ; + while low <= high { + if low * low + high * high == c { + return true; + } else if low * low + high * high < c { + low += 1; + } else { + high -= 1; + } + } + + false + } + + pub fn judge_square_sum_2(c: i32) -> bool { + let mut possible_sqrs = vec![]; + let mut i = 1; + while i*i < c { + possible_sqrs.push(i*i); + i+=1; + } + let mut complements = HashSet::new(); + for &sqr in &possible_sqrs { + if sqr <= c / 2 { + complements.insert(sqr); + } else { + break; + } + } + for &sqr in possible_sqrs.iter().rev() { + if c / 2 < sqr { + if complements.contains(&(c-sqr)) {return true;} + } else { + break; + } + } + + false + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_633() { + } +} diff --git a/src/problem/p0684_redundant_connection.rs b/src/problem/p0684_redundant_connection.rs new file mode 100644 index 00000000..c5a93c98 --- /dev/null +++ b/src/problem/p0684_redundant_connection.rs @@ -0,0 +1,98 @@ +/** + * [684] Redundant Connection + * + * + * In this problem, a tree is an undirected graph that is connected and has no cycles. + * + * The given input is a graph that started as a tree with N nodes (with distinct values 1, 2, ..., N), with one additional edge added. The added edge has two different vertices chosen from 1 to N, and was not an edge that already existed. + * + * The resulting graph is given as a 2D-array of edges. Each element of edges is a pair [u, v] with u < v, that represents an undirected edge connecting nodes u and v. + * + * Return an edge that can be removed so that the resulting graph is a tree of N nodes. If there are multiple answers, return the answer that occurs last in the given 2D-array. The answer edge [u, v] should be in the same format, with u < v. + * Example 1:
+ * + * Input: [[1,2], [1,3], [2,3]] + * Output: [2,3] + * Explanation: The given undirected graph will be like this: + * 1 + * / \ + * 2 - 3 + * + * + * Example 2:
+ * + * Input: [[1,2], [2,3], [3,4], [1,4], [1,5]] + * Output: [1,4] + * Explanation: The given undirected graph will be like this: + * 5 - 1 - 2 + * | | + * 4 - 3 + * + * + * Note:
+ * The size of the input 2D-array will be between 3 and 1000. + * Every integer represented in the 2D-array will be between 1 and N, where N is the size of the input array. + * + * + *
+ * + * + * Update (2017-09-26):
+ * We have overhauled the problem description + test cases and specified clearly the graph is an undirected graph. For the directed graph follow up please see Redundant Connection II). We apologize for any inconvenience caused. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/redundant-connection/ +// discuss: https://leetcode.com/problems/redundant-connection/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_root_with_compress(parents: &mut Vec, target : usize) -> usize { + let mut root = target; + while root != parents[root] { + root = parents[root]; + } + + let mut target = target; + while target != root { + let tmp = parents[target]; + parents[target] = root; + target = tmp; + } + root + } + + pub fn find_redundant_connection(edges: Vec>) -> Vec { + let n = edges.len(); + let mut parents : Vec = (0..=n).collect(); + let mut subset_sizes = vec![1;n+1]; + + for edge in &edges { + let e1 = Self::find_root_with_compress(&mut parents, edge[0] as usize); + let e2 = Self::find_root_with_compress(&mut parents, edge[1] as usize); + if e1 == e2 { + return edge.clone(); + } else if subset_sizes[e1] < subset_sizes[e2] { + parents[e1] = e2; + subset_sizes[e2] += subset_sizes[e1]; + } else { + parents[e2] = e1; + subset_sizes[e1] += subset_sizes[e2]; + } + } + vec![] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_684() { + } +} diff --git a/src/problem/p0685_redundant_connection_ii.rs b/src/problem/p0685_redundant_connection_ii.rs new file mode 100644 index 00000000..3d495783 --- /dev/null +++ b/src/problem/p0685_redundant_connection_ii.rs @@ -0,0 +1,122 @@ +/** + * [685] Redundant Connection II + * + * In this problem, a rooted tree is a directed graph such that, there is exactly one node (the root) for which all other nodes are descendants of this node, plus every node has exactly one parent, except for the root node which has no parents. + * The given input is a directed graph that started as a rooted tree with n nodes (with distinct values from 1 to n), with one additional directed edge added. The added edge has two different vertices chosen from 1 to n, and was not an edge that already existed. + * The resulting graph is given as a 2D-array of edges. Each element of edges is a pair [ui, vi] that represents a directed edge connecting nodes ui and vi, where ui is a parent of child vi. + * Return an edge that can be removed so that the resulting graph is a rooted tree of n nodes. If there are multiple answers, return the answer that occurs last in the given 2D-array. + * + * Example 1: + * + * Input: edges = [[1,2],[1,3],[2,3]] + * Output: [2,3] + * + * Example 2: + * + * Input: edges = [[1,2],[2,3],[3,4],[4,1],[1,5]] + * Output: [4,1] + * + * + * Constraints: + * + * n == edges.length + * 3 <= n <= 1000 + * edges[i].length == 2 + * 1 <= ui, vi <= n + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/redundant-connection-ii/ +// discuss: https://leetcode.com/problems/redundant-connection-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + // for each edge + // if it leads to a node with 2 in-degree: + // if found a cycle: + // return edge1; + // else; + // mark down two edges as edge1 and edge2 + // else + // union two nodes + // if already belong to a subset. return edge1 if non-empty. else mark found cycle. + // return edge2 if non-empty, return last_cyclic_edge + pub fn find_redundant_directed_connection(edges: Vec>) -> Vec { + let n = edges.len(); + let mut parents : Vec = (0..=n).collect(); + let mut subset_sizes : Vec = vec![1usize;n+1]; + let mut in_nodes = vec![0usize;n+1]; // 0 for NA + let mut edge1 = vec![]; // the 1st edge into a common node. + let mut edge2 = vec![]; // the 2nd edge into a common node + let mut last_cycle_edge = None; + for edge in &edges { + let from = edge[0] as usize; + let to = edge[1] as usize; + + if in_nodes[to] == 0 { + // first incoming edges from node to. + in_nodes[to] = from; + + // perform union + let mut from_root = from; + while from_root != parents[from_root] { + from_root = parents[from_root]; + } + + let mut to_root = to; + while to_root != parents[to_root] { + to_root = parents[to_root]; + } + + if from_root == to_root { + if edge1.len() != 0 { + return edge1; + } else { + // try to find an edge leading to a node with two in-degrees later. + last_cycle_edge = Some(vec![from as i32, to as i32]); + } + } else if subset_sizes[from] < subset_sizes[to] { + parents[from_root] = to_root; + subset_sizes[to] += subset_sizes[from]; + } else { + parents[to_root] = from_root; + subset_sizes[from] += subset_sizes[to]; + } + + } else if last_cycle_edge.is_none() { + edge1 = vec![in_nodes[to] as i32, to as i32]; + edge2 = vec![from as i32, to as i32]; + + } else { + edge1 = vec![in_nodes[to] as i32, to as i32]; + return edge1; + } + + } + if last_cycle_edge.is_none() { + edge2 + } else { + last_cycle_edge.unwrap() + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_685() { + assert_eq!(Solution::find_redundant_directed_connection(vec![vec![1,2],vec![2,3],vec![3,4],vec![4,1],vec![1,5]]), vec![4,1]); + + assert_eq!(Solution::find_redundant_directed_connection(vec![vec![1,2],vec![1,3],vec![2,3]]), vec![2,3]); + + assert_eq!(Solution::find_redundant_directed_connection(vec![vec![2,1],vec![3,1],vec![4,2],vec![1,4]]), vec![2,1]); + + assert_eq!(Solution::find_redundant_directed_connection(vec![vec![3,4],vec![4,1],vec![1,2],vec![2,3],vec![5,1]]), vec![4,1]); + } +} diff --git a/src/problem/p0693_binary_number_with_alternating_bits.rs b/src/problem/p0693_binary_number_with_alternating_bits.rs new file mode 100644 index 00000000..7e29f9dc --- /dev/null +++ b/src/problem/p0693_binary_number_with_alternating_bits.rs @@ -0,0 +1,65 @@ +/** + * [693] Binary Number with Alternating Bits + * + * Given a positive integer, check whether it has alternating bits: namely, if two adjacent bits will always have different values. + * + * Example 1: + * + * Input: n = 5 + * Output: true + * Explanation: The binary representation of 5 is: 101 + * + * Example 2: + * + * Input: n = 7 + * Output: false + * Explanation: The binary representation of 7 is: 111. + * Example 3: + * + * Input: n = 11 + * Output: false + * Explanation: The binary representation of 11 is: 1011. + * Example 4: + * + * Input: n = 10 + * Output: true + * Explanation: The binary representation of 10 is: 1010. + * Example 5: + * + * Input: n = 3 + * Output: false + * + * + * Constraints: + * + * 1 <= n <= 2^31 - 1 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/binary-number-with-alternating-bits/ +// discuss: https://leetcode.com/problems/binary-number-with-alternating-bits/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn has_alternating_bits(n: i32) -> bool { + let n = n ^ n >> 1; + (n & (n+1)) == 0 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_693() { + assert!(Solution::has_alternating_bits(5)); + assert!(!Solution::has_alternating_bits(7)); + assert!(!Solution::has_alternating_bits(11)); + assert!(Solution::has_alternating_bits(10)); + } +} diff --git a/src/problem/p0713_subarray_product_less_than_k.rs b/src/problem/p0713_subarray_product_less_than_k.rs new file mode 100644 index 00000000..81576279 --- /dev/null +++ b/src/problem/p0713_subarray_product_less_than_k.rs @@ -0,0 +1,58 @@ +/** + * [713] Subarray Product Less Than K + * + * Your are given an array of positive integers nums. + * Count and print the number of (contiguous) subarrays where the product of all the elements in the subarray is less than k. + * + * Example 1:
+ * + * Input: nums = [10, 5, 2, 6], k = 100 + * Output: 8 + * Explanation: The 8 subarrays that have product less than 100 are: [10], [5], [2], [6], [10, 5], [5, 2], [2, 6], [5, 2, 6]. + * Note that [10, 5, 2] is not included as the product of 100 is not strictly less than k. + * + * + * + * Note: + * 0 < nums.length <= 50000. + * 0 < nums[i] < 1000. + * 0 <= k < 10^6. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/subarray-product-less-than-k/ +// discuss: https://leetcode.com/problems/subarray-product-less-than-k/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn num_subarray_product_less_than_k(nums: Vec, k: i32) -> i32 { + let mut low = 0usize; + let mut high = 0usize; + let mut cur_product = 1; + let mut count = 0; + while high < nums.len() { + cur_product *= nums[high]; + while k <= cur_product && low <= high { + cur_product /= nums[low]; + low+=1; + } + count+=(high-low+1); + high+=1; + } + count as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_713() { + assert_eq!(Solution::num_subarray_product_less_than_k(vec![10,5,2,6], 100), 8); + } +} diff --git a/src/problem/p0714_best_time_to_buy_and_sell_stock_with_transaction_fee.rs b/src/problem/p0714_best_time_to_buy_and_sell_stock_with_transaction_fee.rs new file mode 100644 index 00000000..c7916c56 --- /dev/null +++ b/src/problem/p0714_best_time_to_buy_and_sell_stock_with_transaction_fee.rs @@ -0,0 +1,69 @@ +/** + * [714] Best Time to Buy and Sell Stock with Transaction Fee + * + * You are given an array prices where prices[i] is the price of a given stock on the i^th day, and an integer fee representing a transaction fee. + * Find the maximum profit you can achieve. You may complete as many transactions as you like, but you need to pay the transaction fee for each transaction. + * Note: You may not engage in multiple transactions simultaneously (i.e., you must sell the stock before you buy again). + * + * Example 1: + * + * Input: prices = [1,3,2,8,4,9], fee = 2 + * Output: 8 + * Explanation: The maximum profit can be achieved by: + * - Buying at prices[0] = 1 + * - Selling at prices[3] = 8 + * - Buying at prices[4] = 4 + * - Selling at prices[5] = 9 + * The total profit is ((8 - 1) - 2) + ((9 - 4) - 2) = 8. + * + * Example 2: + * + * Input: prices = [1,3,7,5,10,3], fee = 3 + * Output: 6 + * + * + * Constraints: + * + * 1 <= prices.length <= 5 * 10^4 + * 1 <= prices[i] < 5 * 10^4 + * 0 <= fee < 5 * 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/best-time-to-buy-and-sell-stock-with-transaction-fee/ +// discuss: https://leetcode.com/problems/best-time-to-buy-and-sell-stock-with-transaction-fee/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + + +impl Solution { + pub fn max_profit(prices: Vec, fee: i32) -> i32 { + let mut last_no_stock_balance : i32 = 0; + let mut last_with_stock_balance : i32 = -2_147_483_648i32; + + for price in prices.iter() { + let last_no_stock_balance_cache = last_no_stock_balance; + + last_no_stock_balance = std::cmp::max(last_no_stock_balance, last_with_stock_balance + price); + + // may lead to the overflow. + // last_no_stock_balance = std::cmp::max(last_no_stock_balance, last_with_stock_balance + price - fee); + + // pay the fee during buying + last_with_stock_balance = std::cmp::max(last_with_stock_balance, last_no_stock_balance_cache - price - fee); + } + last_no_stock_balance + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_714() { + } +} diff --git a/src/problem/p0718_maximum_length_of_repeated_subarray.rs b/src/problem/p0718_maximum_length_of_repeated_subarray.rs new file mode 100644 index 00000000..95d15ed3 --- /dev/null +++ b/src/problem/p0718_maximum_length_of_repeated_subarray.rs @@ -0,0 +1,93 @@ +/** + * [718] Maximum Length of Repeated Subarray + * + * Given two integer arrays A and B, return the maximum length of an subarray that appears in both arrays. + * + * Example 1: + * + * + * Input: + * A: [1,2,3,2,1] + * B: [3,2,1,4,7] + * Output: 3 + * Explanation: + * The repeated subarray with maximum length is [3, 2, 1]. + * + * + * + * + * Note: + * + *
    + * 1 <= len(A), len(B) <= 1000 + * 0 <= A[i], B[i] < 100 + *
+ * + * + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/maximum-length-of-repeated-subarray/ +// discuss: https://leetcode.com/problems/maximum-length-of-repeated-subarray/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn find_length(a: Vec, b: Vec) -> i32 { + let mut result = vec![vec![0;b.len() + 1];a.len() + 1]; + let mut cur_max = 0; + + for i in 1..=a.len() { + for j in 1..=b.len() { + if a[i-1] == b[j-1] { + result[i][j] = result[i-1][j-1] + 1; + cur_max = std::cmp::max(cur_max, result[i][j]); + } + } + } + + cur_max + } + + pub fn find_length_standard(a: Vec, b: Vec) -> i32 { + let mut num2positions : HashMap> = HashMap::new(); + for (i, &num) in b.iter().enumerate() { + if let Some(ps) = num2positions.get_mut(&num) { + ps.push(i); + } else { + num2positions.insert(num, vec![i]); + } + } + let mut max_len = 0; + for (a_start, &a_num) in a.iter().enumerate() { + if let Some(b_positions) = num2positions.get(&a_num) { + for &b_start in b_positions { + let mut cur_l = 0; + let mut a_i = a_start; + let mut b_i = b_start; + while a_i < a.len() && b_i < b.len() && a[a_i] == b[b_i] { + a_i+=1; + b_i+=1; + cur_l+=1; + } + max_len = std::cmp::max(max_len, cur_l); + } + } + } + + max_len + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_718() { + assert_eq!(Solution::find_length(vec![1,2,3,2,1], vec![3,2,1,4,7]), 3); + } +} diff --git a/src/problem/p0721_accounts_merge.rs b/src/problem/p0721_accounts_merge.rs new file mode 100644 index 00000000..7b1802c2 --- /dev/null +++ b/src/problem/p0721_accounts_merge.rs @@ -0,0 +1,122 @@ +/** + * [721] Accounts Merge + * + * Given a list of accounts where each element accounts[i] is a list of strings, where the first element accounts[i][0] is a name, and the rest of the elements are emails representing emails of the account. + * Now, we would like to merge these accounts. Two accounts definitely belong to the same person if there is some common email to both accounts. Note that even if two accounts have the same name, they may belong to different people as people could have the same name. A person can have any number of accounts initially, but all of their accounts definitely have the same name. + * After merging the accounts, return the accounts in the following format: the first element of each account is the name, and the rest of the elements are emails in sorted order. The accounts themselves can be returned in any order. + * + * Example 1: + * + * Input: accounts = [["John","johnsmith@mail.com","john_newyork@mail.com"],["John","johnsmith@mail.com","john00@mail.com"],["Mary","mary@mail.com"],["John","johnnybravo@mail.com"]] + * Output: [["John","john00@mail.com","john_newyork@mail.com","johnsmith@mail.com"],["Mary","mary@mail.com"],["John","johnnybravo@mail.com"]] + * Explanation: + * The first and third John's are the same person as they have the common email "johnsmith@mail.com". + * The second John and Mary are different people as none of their email addresses are used by other accounts. + * We could return these lists in any order, for example the answer [['Mary', 'mary@mail.com'], ['John', 'johnnybravo@mail.com'], + * ['John', 'john00@mail.com', 'john_newyork@mail.com', 'johnsmith@mail.com']] would still be accepted. + * + * Example 2: + * + * Input: accounts = [["Gabe","Gabe0@m.co","Gabe3@m.co","Gabe1@m.co"],["Kevin","Kevin3@m.co","Kevin5@m.co","Kevin0@m.co"],["Ethan","Ethan5@m.co","Ethan4@m.co","Ethan0@m.co"],["Hanzo","Hanzo3@m.co","Hanzo1@m.co","Hanzo0@m.co"],["Fern","Fern5@m.co","Fern1@m.co","Fern0@m.co"]] + * Output: [["Ethan","Ethan0@m.co","Ethan4@m.co","Ethan5@m.co"],["Gabe","Gabe0@m.co","Gabe1@m.co","Gabe3@m.co"],["Hanzo","Hanzo0@m.co","Hanzo1@m.co","Hanzo3@m.co"],["Kevin","Kevin0@m.co","Kevin3@m.co","Kevin5@m.co"],["Fern","Fern0@m.co","Fern1@m.co","Fern5@m.co"]] + * + * + * Constraints: + * + * 1 <= accounts.length <= 1000 + * 2 <= accounts[i].length <= 10 + * 1 <= accounts[i][j] <= 30 + * accounts[i][0] consists of English letters. + * accounts[i][j] (for j > 0) is a valid email. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/accounts-merge/ +// discuss: https://leetcode.com/problems/accounts-merge/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn accounts_merge(accounts: Vec>) -> Vec> { + let mut email2name = HashMap::new(); + let mut email_parents : HashMap = HashMap::new(); + for account in &accounts { + let name = account[0].clone(); + + // If an email already exists, find its root email + // If none, arbitrarly select the first email. + let mut this_parent = account[1].clone(); + for i in 1..account.len() { + let email = account[i].clone(); + if email_parents.contains_key(&email) { + + this_parent = account[i].clone(); + while this_parent != email_parents[&this_parent] { + this_parent = email_parents[&this_parent].clone(); + } + break; + } + } + + // All emails update the above found email as the root. + for i in 1..account.len() { + let email = account[i].clone(); + let mut this_root = account[i].clone(); + if email_parents.contains_key(&email) { + while this_root != email_parents[&this_root] { + this_root = email_parents[&this_root].clone(); + } + } else { + email2name.insert(email.clone(), name.clone()); + } + + email_parents.insert(this_root.clone(), this_parent.clone()); + } + } + + let mut email_result = vec![]; + let mut root2result_pos = HashMap::new(); + for (email, parent) in email_parents.iter() { + if email == parent { + // find a root. + root2result_pos.insert(email.clone(), email_result.len()); + email_result.push(vec![]); + } + } + + + for (email, parent) in email_parents.iter() { + let mut acc = vec![email2name[email].clone()]; + let mut email_root = email.clone(); + while email_root != email_parents[&email_root] { + email_root = email_parents[&email_root].clone(); + } + let result_pos = root2result_pos[&email_root]; + email_result[result_pos].push(email.clone()); + } + + let mut result = vec![]; + for (root_email, &pos) in root2result_pos.iter() { + email_result[pos].sort(); + let acc = email2name[root_email].clone(); + let mut r = vec![acc]; + r.append(&mut email_result[pos]); + result.push(r); + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_721() { + // assert_eq!(Solution::accounts_merge(vec![vec!["John".to_owned(),"johnsmith@mail.com".to_owned(),"john_newyork@mail.com".to_owned()],vec!["John".to_owned(),"johnsmith@mail.com".to_owned(),"john00@mail.com".to_owned()],vec!["Mary".to_owned(),"mary@mail.com".to_owned()],vec!["John".to_owned(),"johnnybravo@mail.com".to_owned()]]), vec![vec!["John".to_owned(),"john00@mail.com".to_owned(),"john_newyork@mail.com".to_owned(),"johnsmith@mail.com".to_owned()],vec!["Mary".to_owned(),"mary@mail.com".to_owned()],vec!["John".to_owned(),"johnnybravo@mail.com".to_owned()]] + // ); + } +} diff --git a/src/problem/p0726_number_of_atoms.rs b/src/problem/p0726_number_of_atoms.rs new file mode 100644 index 00000000..90d1676a --- /dev/null +++ b/src/problem/p0726_number_of_atoms.rs @@ -0,0 +1,146 @@ +/** + * [726] Number of Atoms + * + * Given a chemical formula (given as a string), return the count of each atom. + * The atomic element always starts with an uppercase character, then zero or more lowercase letters, representing the name. + * One or more digits representing that element's count may follow if the count is greater than 1. If the count is 1, no digits will follow. For example, H2O and H2O2 are possible, but H1O2 is impossible. + * Two formulas concatenated together to produce another formula. For example, H2O2He3Mg4 is also a formula. + * A formula placed in parentheses, and a count (optionally added) is also a formula. For example, (H2O2) and (H2O2)3 are formulas. + * Given a formula, return the count of all elements as a string in the following form: the first name (in sorted order), followed by its count (if that count is more than 1), followed by the second name (in sorted order), followed by its count (if that count is more than 1), and so on. + * + * + * Example 1: + * + * Input: formula = "H2O" + * Output: "H2O" + * Explanation: The count of elements are {'H': 2, 'O': 1}. + * + * Example 2: + * + * Input: formula = "Mg(OH)2" + * Output: "H2MgO2" + * Explanation: The count of elements are {'H': 2, 'Mg': 1, 'O': 2}. + * + * Example 3: + * + * Input: formula = "K4(ON(SO3)2)2" + * Output: "K4N2O14S4" + * Explanation: The count of elements are {'K': 4, 'N': 2, 'O': 14, 'S': 4}. + * + * Example 4: + * + * Input: formula = "Be32" + * Output: "Be32" + * + * + * Constraints: + * + * 1 <= formula.length <= 1000 + * formula consists of English letters, digits, '(', and ')'. + * formula is always valid. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/number-of-atoms/ +// discuss: https://leetcode.com/problems/number-of-atoms/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::BTreeMap; + +impl Solution { + pub fn process(last_element : &mut String, last_digit : &mut String, last_parsed : &mut BTreeMap, my_parsed : &mut BTreeMap) { + let mut count = 1usize; + if last_digit.len() != 0 { + count = last_digit.parse::().unwrap(); + *last_digit = "".to_owned(); + } + + if last_element.len() != 0 { + *(my_parsed.entry(last_element.clone()).or_insert(0)) +=count; + *last_element = "".to_owned(); + } else if last_parsed.len() != 0 { + for (key, val) in last_parsed.iter() { + *(my_parsed.entry(key.clone()).or_insert(0)) +=(*val*count); + } + last_parsed.clear(); + } else { + // panic!("Can not be both empty..."); + // can be empty at the start + } + + } + pub fn helper(formula: String) -> BTreeMap { + let l = formula.len(); + let mut i = 0usize; + let mut my_parsed : BTreeMap = BTreeMap::new(); + let mut last_element = "".to_owned(); + let mut last_digit = "".to_owned(); + let mut last_parsed : BTreeMap = BTreeMap::new(); + while i < l { + let mut cur_char : char = formula.chars().nth(i).unwrap(); + if cur_char.is_ascii_digit() { + last_digit.push(cur_char); + } else if 'A' <= cur_char && cur_char <= 'Z' { + Self::process(&mut last_element, &mut last_digit, &mut last_parsed, &mut my_parsed); + + last_element.push(cur_char); + + } else if 'a' <= cur_char && cur_char <= 'z' { + last_element.push(cur_char); + } else if cur_char == '(' { + // process first + Self::process(&mut last_element, &mut last_digit, &mut last_parsed, &mut my_parsed); + let mut left_bracket_count = 1; + let mut sub_formula = "".to_owned(); + loop { + i+=1; + let sub_char = formula.chars().nth(i).unwrap(); + if sub_char == ')' { + left_bracket_count-=1; + if left_bracket_count == 0 {break;} + } + + if sub_char == '(' { + left_bracket_count+=1; + } + sub_formula.push(formula.chars().nth(i).unwrap()); + } + last_parsed = Self::helper(sub_formula); + } else { + panic!("Shall not encounter {}", cur_char); + } + // println!("formula={}, i={}, cur_char={}, last_digit={}, last_element={}, last_parsed={:?}", formula, i, cur_char, last_digit, last_element, last_parsed); + i+=1; + } + Self::process(&mut last_element, &mut last_digit, &mut last_parsed, &mut my_parsed); + my_parsed + } + + pub fn count_of_atoms(formula: String) -> String { + let mut parsed = Self::helper(formula); + let mut result = "".to_owned(); + for (element, count) in parsed.iter() { + result.extend(element.clone().chars()); + if *count > 1 { + result.extend(count.to_string().to_owned().chars()); + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_726() { + assert_eq!(Solution::count_of_atoms("H2O".to_owned()), "H2O".to_owned()); + assert_eq!(Solution::count_of_atoms("Mg(OH)2".to_owned()), "H2MgO2".to_owned()); + assert_eq!(Solution::count_of_atoms("Be32".to_owned()), "Be32".to_owned()); + assert_eq!(Solution::count_of_atoms("K4(ON(SO3)2)2".to_owned()), "K4N2O14S4".to_owned()); + } +} diff --git a/src/problem/p0763_partition_labels.rs b/src/problem/p0763_partition_labels.rs new file mode 100644 index 00000000..74ce148e --- /dev/null +++ b/src/problem/p0763_partition_labels.rs @@ -0,0 +1,76 @@ +/** + * [763] Partition Labels + * + * A string S of lowercase English letters is given. We want to partition this string into as many parts as possible so that each letter appears in at most one part, and return a list of integers representing the size of these parts. + * + * Example 1: + * + * Input: S = "ababcbacadefegdehijhklij" + * Output: [9,7,8] + * Explanation: + * The partition is "ababcbaca", "defegde", "hijhklij". + * This is a partition so that each letter appears in at most one part. + * A partition like "ababcbacadefegde", "hijhklij" is incorrect, because it splits S into less parts. + * + * + * Note: + * + * S will have length in range [1, 500]. + * S will consist of lowercase English letters ('a' to 'z') only. + * + * + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/partition-labels/ +// discuss: https://leetcode.com/problems/partition-labels/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn char2idx(c : char) ->usize { + let base_idx = 'a' as u8 as usize; + let c_idx = c as u8 as usize; + c_idx - base_idx + } + + pub fn partition_labels(s: String) -> Vec { + let mut result = vec![]; + + let mut char_positions= vec![vec![];26]; + for (i,c) in s.chars().enumerate() { + char_positions[Self::char2idx(c)].push(i); + } + + let mut i = 0; + // println!("char_positions: {:?}", char_positions); + let ss : Vec = s.chars().collect(); + while i < s.len() { + let mut l = 0; + let mut cur_max = i; + while i <= cur_max { + let cur_char = Self::char2idx(ss[i]); + cur_max = std::cmp::max(cur_max, *char_positions[cur_char].iter().max().unwrap()); + // println!("i={}, cur_char={}, cur_max={}", i, cur_char, cur_max); + i+=1; + l+=1; + } + result.push(l); + } + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_763() { + assert_eq!(Solution::partition_labels("ababcbacadefegdehijhklij".to_owned()), vec![9,7,8]); + } +} diff --git a/src/problem/p0767_reorganize_string.rs b/src/problem/p0767_reorganize_string.rs new file mode 100644 index 00000000..543b24d7 --- /dev/null +++ b/src/problem/p0767_reorganize_string.rs @@ -0,0 +1,82 @@ +/** + * [767] Reorganize String + * + * Given a string S, check if the letters can be rearranged so that two characters that are adjacent to each other are not the same. + * + * If possible, output any possible result. If not possible, return the empty string. + * + * Example 1: + * + * + * Input: S = "aab" + * Output: "aba" + * + * + * Example 2: + * + * + * Input: S = "aaab" + * Output: "" + * + * + * Note: + * + * + * S will consist of lowercase letters and have length in range [1, 500]. + * + * + * + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/reorganize-string/ +// discuss: https://leetcode.com/problems/reorganize-string/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn reorganize_string(s: String) -> String { + let mut char_counts : Vec = vec![0;26]; + for c in s.chars() { + char_counts[c as u8 as usize - 'a' as u8 as usize] +=1; + } + let n = s.len(); + let mut idx_map : Vec = (0..(n+1)/2).map(|x|{2*x}).collect(); + idx_map.extend((0..(n/2)).map(|x|{2*x+1}).collect::>()); + + let mut i : usize = 0; + let mut result : Vec = vec!['a';n]; + while i < n { + let mut cur_max_char = 0; + let mut cur_max_count = 0; + for c in 0..26 { + if cur_max_count < char_counts[c] { + cur_max_char = c; + cur_max_count = char_counts[c]; + } + } + if cur_max_count > (n+1)/2 {return "".to_owned();}; + let end = i + cur_max_count; + // println!("i={}, n={}, end={}, cur_max_char={}",i,n, end, cur_max_char); + while i < end { + result[idx_map[i]] = ('a' as u8 + cur_max_char as u8) as char; + i+=1; + } + char_counts[cur_max_char] = 0; + } + result.iter().collect() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_767() { + assert_eq!(Solution::reorganize_string("abbabbaaab".to_owned()),"ababababab"); + } +} diff --git a/src/problem/p0781_rabbits_in_forest.rs b/src/problem/p0781_rabbits_in_forest.rs new file mode 100644 index 00000000..837669f1 --- /dev/null +++ b/src/problem/p0781_rabbits_in_forest.rs @@ -0,0 +1,78 @@ +/** + * [781] Rabbits in Forest + * + * In a forest, each rabbit has some color. Some subset of rabbits (possibly all of them) tell you how many other rabbits have the same color as them. Those answers are placed in an array. + * + * Return the minimum number of rabbits that could be in the forest. + * + * + * Examples: + * Input: answers = [1, 1, 2] + * Output: 5 + * Explanation: + * The two rabbits that answered "1" could both be the same color, say red. + * The rabbit than answered "2" can't be red or the answers would be inconsistent. + * Say the rabbit that answered "2" was blue. + * Then there should be 2 other blue rabbits in the forest that didn't answer into the array. + * The smallest possible number of rabbits in the forest is therefore 5: 3 that answered plus 2 that didn't. + * + * Input: answers = [10, 10, 10] + * Output: 11 + * + * Input: answers = [] + * Output: 0 + * + * + * Note: + * + *
    + * answers will have length at most 1000. + * Each answers[i] will be an integer in the range [0, 999]. + *
+ * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/rabbits-in-forest/ +// discuss: https://leetcode.com/problems/rabbits-in-forest/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn num_rabbits(answers: Vec) -> i32 { + let mut count = HashMap::new(); + for answer in answers { + if let Some(c) = count.get_mut(&answer) { + *c += 1; + } else { + count.insert(answer, 1); + } + } + + let mut result = 0; + + for (num, count) in count { + if count % (num+1) == 0 { + result += count; + } else { + result += (count / (num+1) + 1) * (num+1); + } + println!("num={}, count={} result={}", num, count, result); + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_781() { + assert_eq!(Solution::num_rabbits(vec![1, 1, 2]), 5); + assert_eq!(Solution::num_rabbits(vec![10, 10, 10]), 11); + assert_eq!(Solution::num_rabbits(vec![]), 0); + } +} diff --git a/src/problem/p0803_bricks_falling_when_hit.rs b/src/problem/p0803_bricks_falling_when_hit.rs new file mode 100644 index 00000000..51a6b7b6 --- /dev/null +++ b/src/problem/p0803_bricks_falling_when_hit.rs @@ -0,0 +1,334 @@ +/** + * [803] Bricks Falling When Hit + * + * You are given an m x n binary grid, where each 1 represents a brick and 0 represents an empty space. A brick is stable if: + * + * It is directly connected to the top of the grid, or + * At least one other brick in its four adjacent cells is stable. + * + * You are also given an array hits, which is a sequence of erasures we want to apply. Each time we want to erase the brick at the location hits[i] = (rowi, coli). The brick on that location (if it exists) will disappear. Some other bricks may no longer be stable because of that erasure and will fall. Once a brick falls, it is immediately erased from the grid (i.e., it does not land on other stable bricks). + * Return an array result, where each result[i] is the number of bricks that will fall after the i^th erasure is applied. + * Note that an erasure may refer to a location with no brick, and if it does, no bricks drop. + * + * Example 1: + * + * Input: grid = [[1,0,0,0],[1,1,1,0]], hits = [[1,0]] + * Output: [2] + * Explanation: Starting with the grid: + * [[1,0,0,0], + * [1,1,1,0]] + * We erase the underlined brick at (1,0), resulting in the grid: + * [[1,0,0,0], + * [0,1,1,0]] + * The two underlined bricks are no longer stable as they are no longer connected to the top nor adjacent to another stable brick, so they will fall. The resulting grid is: + * [[1,0,0,0], + * [0,0,0,0]] + * Hence the result is [2]. + * + * Example 2: + * + * Input: grid = [[1,0,0,0],[1,1,0,0]], hits = [[1,1],[1,0]] + * Output: [0,0] + * Explanation: Starting with the grid: + * [[1,0,0,0], + * [1,1,0,0]] + * We erase the underlined brick at (1,1), resulting in the grid: + * [[1,0,0,0], + * [1,0,0,0]] + * All remaining bricks are still stable, so no bricks fall. The grid remains the same: + * [[1,0,0,0], + * [1,0,0,0]] + * Next, we erase the underlined brick at (1,0), resulting in the grid: + * [[1,0,0,0], + * [0,0,0,0]] + * Once again, all remaining bricks are still stable, so no bricks fall. + * Hence the result is [0,0]. + * + * + * Constraints: + * + * m == grid.length + * n == grid[i].length + * 1 <= m, n <= 200 + * grid[i][j] is 0 or 1. + * 1 <= hits.length <= 4 * 10^4 + * hits[i].length == 2 + * 0 <= xi <= m - 1 + * 0 <= yi <= n - 1 + * All (xi, yi) are unique. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/bricks-falling-when-hit/ +// discuss: https://leetcode.com/problems/bricks-falling-when-hit/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +use std::collections::HashSet; +impl Solution { + + pub fn find_with_compression(parents: &mut HashMap, target : i32) -> i32 { + if parents.contains_key(&target) { + let mut root = target; + while root != parents[&root] { + root = parents[&root]; + } + + let mut target = target; + while target != parents[&target] { + let tmp = parents[&target]; + parents.insert(target, root); + target = tmp; + } + root + } else { + -1 + } + } + + pub fn union(parents: &mut HashMap, subset_sizes: &mut HashMap, e1 : i32, e2 : i32, col_count : i32) -> bool { + let mut e1_root : i32 = Self::find_with_compression(parents, e1); + if e1_root == -1 { + parents.insert(e1, e1); + subset_sizes.insert(e1, 1usize); + e1_root = e1; + } + + let mut e2_root : i32 = Self::find_with_compression(parents, e2); + if e2_root == -1 { + parents.insert(e2, e2); + subset_sizes.insert(e2, 1usize); + e2_root = e2; + } + + // println!("parents={:?}, subset_sizes={:?}, e1={}, e1_root={}, e2={}, e2_root={}", parents, subset_sizes, e1, e1_root, e2, e2_root); + + if e1_root == e2_root { return false; } + + let mut by_size = false; + let mut from_root : i32 = 0; + let mut from_size = 0usize; + let mut to_root : i32 = 0; + let mut to_size = 0usize; + + if e1_root / col_count == 0 && e2_root / col_count == 0 { + by_size = true; + } else if e1_root / col_count == 0 { + to_root = e1_root; + from_root = e2_root; + } else if e2_root / col_count == 0 { + to_root = e2_root; + from_root = e1_root; + } else { + by_size = true; + } + + if by_size { + let e1_root_size = subset_sizes[&e1_root]; + let e2_root_size = subset_sizes[&e2_root]; + if e1_root_size < e2_root_size { + from_size = e1_root_size; + from_root = e1_root; + to_root = e2_root; + to_size = e2_root_size; + } else { + from_size = e2_root_size; + from_root = e2_root; + to_root = e1_root; + to_size = e1_root_size; + } + } + + parents.insert(from_root, to_root); + subset_sizes.insert(to_root, to_size + from_size); + true + } + + + + pub fn hit_bricks(mut grid: Vec>, hits: Vec>) -> Vec { + // build post-hit grid + // union all bricks, with bricks at top are preferred as representatives. + // count and mark all unstable bricks. + // for each hit reversely. + // union the neighbor bricks. + // count unstable bricks that turn stable. + let mut post_grid = grid.clone(); + for hit in &hits { + post_grid[hit[0] as usize][hit[1] as usize] = 0; + } + + let row_count : usize = grid.len(); + let col_count : usize = grid[0].len(); + + let mut parents : HashMap = HashMap::new(); + let mut subset_sizes : HashMap = HashMap::new(); + + for i in 0..row_count { + for j in 0..col_count { + let e1 = i * col_count + j; + if post_grid[i][j] == 1 { + Self::union(&mut parents, &mut subset_sizes, e1 as i32, e1 as i32, col_count as i32); + } + + if post_grid[i][j] == 1 && i < row_count-1 && post_grid[i+1][j] == 1 { + let e1 = i * col_count + j; + let e2 = (i+1) * col_count + j; + Self::union(&mut parents, &mut subset_sizes, e1 as i32, e2 as i32, col_count as i32); + } + + if post_grid[i][j] == 1 && j < col_count-1 && post_grid[i][j+1] == 1 { + let e1 = i * col_count + j; + let e2 = i * col_count + j + 1; + Self::union(&mut parents, &mut subset_sizes, e1 as i32, e2 as i32, col_count as i32); + } + } + } + + + // println!("POST parents:{:?}, subset_sizes:{:?}", parents, subset_sizes); + + let mut unstables : HashSet = HashSet::new(); + for (e, parent) in &parents { + if parent/ (col_count as i32) != 0 { + unstables.insert(*e); + } + } + let mut result = vec![]; + for i in (0..hits.len()).rev() { + let hit_i = hits[i][0] as usize; + let hit_j = hits[i][1] as usize; + if grid[hit_i][hit_j] == 0 { + result.push(0); + continue; + } + let e : i32 = (hit_i * col_count + hit_j) as i32; + post_grid[hit_i][hit_j] = 1; + + Self::union(&mut parents, &mut subset_sizes, e, e, col_count as i32); + + if 0 < hit_i && post_grid[hit_i-1][hit_j] == 1 { + let e1 : i32 = ((hit_i-1) * col_count + hit_j) as i32; + Self::union(&mut parents, &mut subset_sizes, e, e1, col_count as i32); + } + + if 0 < hit_j && post_grid[hit_i][hit_j-1] == 1 { + let e1 : i32 = (hit_i * col_count + hit_j-1) as i32; + Self::union(&mut parents, &mut subset_sizes, e, e1, col_count as i32); + } + + if hit_i + 1 < row_count && post_grid[hit_i+1][hit_j] == 1 { + let e1 : i32 = ((hit_i+1) * col_count + hit_j) as i32; + Self::union(&mut parents, &mut subset_sizes, e, e1, col_count as i32); + } + + if hit_j + 1 < col_count && post_grid[hit_i][hit_j+1] == 1 { + let e1 : i32 = (hit_i * col_count + hit_j+1) as i32; + Self::union(&mut parents, &mut subset_sizes, e, e1, col_count as i32); + } + + let this_root : i32 = Self::find_with_compression(&mut parents, e) as i32; + if this_root / (col_count as i32) != 0 { + unstables.insert(e); + } + // println!("AFTER hit={:?} parents:{:?}, subset_sizes:{:?}, unstables={:?}", hits[i], parents, subset_sizes, unstables); + + let mut stables = vec![]; + for &unstable in &unstables { + let root : i32 = Self::find_with_compression(&mut parents, unstable); + // println!("\tunstable={}, root={}", unstable, root); + if root / (col_count as i32) == 0 { + stables.push(unstable); + } + } + + for &stable in &stables { + unstables.remove(&stable); + } + result.push(stables.len() as i32); + // println!("\tunstables={:?}, stables={:?}, result={:?}", unstables, stables, result); + + } + result.reverse(); + result + } + + pub fn dfs(grid: &mut Vec>, i : i32, j : i32, set_size: &mut usize) { + let row_count = grid.len() as i32; + let col_count = grid[0].len() as i32; + if 0 <= i && i < row_count && 0 <= j && j < col_count && grid[i as usize][j as usize] == -1 { + grid[i as usize][j as usize] = 1; + *set_size+=1; + Self::dfs(grid, i+1,j, set_size); + Self::dfs(grid, i-1,j, set_size); + Self::dfs(grid, i,j+1, set_size); + Self::dfs(grid, i,j-1, set_size); + } + } + + + pub fn hit_bricks_dfs(mut grid: Vec>, hits: Vec>) -> Vec { + let mut result = vec![]; + for hit in &hits { + let i = hit[0] as usize; + let j = hit[1] as usize; + if grid[i][j] != 1 { + result.push(0); + continue; + } + grid[i][j] = 0; + let row_count : usize = grid.len(); + let col_count : usize = grid[0].len(); + + let mut cur_blk_count : usize = 0; + for i in 0..row_count { + for j in 0..col_count { + if grid[i][j] == 1 { + grid[i][j] = -1; + cur_blk_count +=1; + } + } + } + + for j in 0..col_count { + if grid[0][j] == -1 { + let mut set_size : usize = 0; + // set brick to 1 during traversal. + Self::dfs(&mut grid, 0, j as i32, &mut set_size); + cur_blk_count -= set_size; + } + } + result.push(cur_blk_count as i32); + } + + // for each hit. + // if hits a brick, mark the position as 0. + // mark all bricks as -1 and count as cur_brick. + // for -1/brick at the top, + // perform dfs to mark neighbor as i and return set_size. + // cur_brick -= set size + // push result with cur_brick, which is the fallen bricks. + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_803() { + assert_eq!(Solution::hit_bricks(vec![vec![1,0,0,0],vec![1,1,1,0]], vec![vec![1,0]]), vec![2]); + + assert_eq!(Solution::hit_bricks(vec![vec![1,0,0,0],vec![1,1,0,0]], vec![vec![1,1], vec![1,0]]), vec![0,0]); + + assert_eq!(Solution::hit_bricks(vec![vec![1],vec![1],vec![1],vec![1],vec![1]], vec![vec![3,0], vec![4,0], vec![1,0], vec![2,0], vec![0,0]]), vec![1,0,1,0,0]); + + + assert_eq!(Solution::hit_bricks(vec![vec![1,1,1],vec![0,1,0],vec![0,0,0]], vec![vec![0,2],vec![2,0],vec![0,1],vec![1,2]]), vec![0,0,1,0]); + + } +} diff --git a/src/problem/p0875_koko_eating_bananas.rs b/src/problem/p0875_koko_eating_bananas.rs new file mode 100644 index 00000000..c9cf9d76 --- /dev/null +++ b/src/problem/p0875_koko_eating_bananas.rs @@ -0,0 +1,73 @@ +/** + * [875] Koko Eating Bananas + * + * Koko loves to eat bananas. There are n piles of bananas, the i^th pile has piles[i] bananas. The guards have gone and will come back in h hours. + * Koko can decide her bananas-per-hour eating speed of k. Each hour, she chooses some pile of bananas and eats k bananas from that pile. If the pile has less than k bananas, she eats all of them instead and will not eat any more bananas during this hour. + * Koko likes to eat slowly but still wants to finish eating all the bananas before the guards return. + * Return the minimum integer k such that she can eat all the bananas within h hours. + * + * Example 1: + * + * Input: piles = [3,6,7,11], h = 8 + * Output: 4 + * + * Example 2: + * + * Input: piles = [30,11,23,4,20], h = 5 + * Output: 30 + * + * Example 3: + * + * Input: piles = [30,11,23,4,20], h = 6 + * Output: 23 + * + * + * Constraints: + * + * 1 <= piles.length <= 10^4 + * piles.length <= h <= 10^9 + * 1 <= piles[i] <= 10^9 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/koko-eating-bananas/ +// discuss: https://leetcode.com/problems/koko-eating-bananas/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn min_eating_speed(piles: Vec, h: i32) -> i32 { + let mut low_speed : i32 = 1; + let mut high_speed : i32 = *piles.iter().max().unwrap(); + // < here as we are sure to find an answer. + while low_speed < high_speed { + let mid_speed : i32 = (low_speed + high_speed) / 2; + let hours : i32 = piles.iter().map(|&p|{ + if p % mid_speed == 0 { + p / mid_speed + } else { + p / mid_speed + 1 + } + }).sum(); + if hours <= h { + // this speed is acceptable, and we try to continue searching lowimum + high_speed = mid_speed; + } else { + low_speed = mid_speed + 1; + } + } + low_speed + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_875() { + } +} diff --git a/src/problem/p0885_spiral_matrix_iii.rs b/src/problem/p0885_spiral_matrix_iii.rs new file mode 100644 index 00000000..57346d6c --- /dev/null +++ b/src/problem/p0885_spiral_matrix_iii.rs @@ -0,0 +1,129 @@ +/** + * [885] Spiral Matrix III + * + * On a 2 dimensional grid with R rows and C columns, we start at (r0, c0) facing east. + * + * Here, the north-west corner of the grid is at the first row and column, and the south-east corner of the grid is at the last row and column. + * + * Now, we walk in a clockwise spiral shape to visit every position in this grid. + * + * Whenever we would move outside the boundary of the grid, we continue our walk outside the grid (but may return to the grid boundary later.) + * + * Eventually, we reach all R * C spaces of the grid. + * + * Return a list of coordinates representing the positions of the grid in the order they were visited. + * + * + * + * Example 1: + * + * + * Input: R = 1, C = 4, r0 = 0, c0 = 0 + * Output: [[0,0],[0,1],[0,2],[0,3]] + * + * + * + * + * + * + * Example 2: + * + * + * Input: R = 5, C = 6, r0 = 1, c0 = 4 + * Output: [[1,4],[1,5],[2,5],[2,4],[2,3],[1,3],[0,3],[0,4],[0,5],[3,5],[3,4],[3,3],[3,2],[2,2],[1,2],[0,2],[4,5],[4,4],[4,3],[4,2],[4,1],[3,1],[2,1],[1,1],[0,1],[4,0],[3,0],[2,0],[1,0],[0,0]] + * + * + * + * + *
+ *
+ * + * + * Note: + * + *
    + * 1 <= R <= 100 + * 1 <= C <= 100 + * 0 <= r0 < R + * 0 <= c0 < C + *
+ *
+ *
+ */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/spiral-matrix-iii/ +// discuss: https://leetcode.com/problems/spiral-matrix-iii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn valid(r: i32, c: i32, r0: i32, c0: i32) -> bool { + return 0 <= r0 && r0 < r && 0 <= c0 && c0 < c; + } + + pub fn spiral_matrix_iii(r: i32, c: i32, r0: i32, c0: i32) -> Vec> { + let mut result = vec![]; + let mut cur_row_idx = r0; + let mut cur_col_idx = c0; + + let mut direction_step = 1usize; + 'outer: loop { + // move right + for j in 0..direction_step { + if Self::valid(r, c, cur_row_idx, cur_col_idx) { + result.push(vec![cur_row_idx, cur_col_idx]); + if result.len() as i32 == r * c {break 'outer} + } + cur_col_idx += 1; + } + + // move down + for i in 0..direction_step { + if Self::valid(r, c, cur_row_idx, cur_col_idx) { + result.push(vec![cur_row_idx, cur_col_idx]); + if result.len() as i32 == r * c {break 'outer} + } + cur_row_idx += 1; + } + + direction_step += 1; + + // move left + for j in 0..direction_step { + if Self::valid(r, c, cur_row_idx, cur_col_idx) { + result.push(vec![cur_row_idx, cur_col_idx]); + if result.len() as i32 == r * c {break 'outer} + } + cur_col_idx -= 1; + } + + // move up + for i in 0..direction_step { + if Self::valid(r, c, cur_row_idx, cur_col_idx) { + result.push(vec![cur_row_idx, cur_col_idx]); + if result.len() as i32 == r * c {break 'outer} + } + cur_row_idx -= 1; + + } + direction_step += 1; + } + + + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_885() { + assert_eq!(Solution::spiral_matrix_iii(1, 4, 0, 0), vec![vec![0, 0], vec![0, 1], vec![0, 2], vec![0, 3]]); + + } +} diff --git a/src/problem/p0907_sum_of_subarray_minimums.rs b/src/problem/p0907_sum_of_subarray_minimums.rs new file mode 100644 index 00000000..1f7b398e --- /dev/null +++ b/src/problem/p0907_sum_of_subarray_minimums.rs @@ -0,0 +1,102 @@ +/** + * [907] Sum of Subarray Minimums + * + * Given an array of integers arr, find the sum of min(b), where b ranges over every (contiguous) subarray of arr. Since the answer may be large, return the answer modulo 10^9 + 7. + * + * Example 1: + * + * Input: arr = [3,1,2,4] + * Output: 17 + * Explanation: + * Subarrays are [3], [1], [2], [4], [3,1], [1,2], [2,4], [3,1,2], [1,2,4], [3,1,2,4]. + * Minimums are 3, 1, 2, 4, 1, 1, 2, 1, 1, 1. + * Sum is 17. + * + * Example 2: + * + * Input: arr = [11,81,94,43,3] + * Output: 444 + * + * + * Constraints: + * + * 1 <= arr.length <= 3 * 10^4 + * 1 <= arr[i] <= 3 * 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/sum-of-subarray-minimums/ +// discuss: https://leetcode.com/problems/sum-of-subarray-minimums/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +#[derive(Debug)] +struct Pair(i32, // num + i32, // count + i32 // sum of num*count for each pair in the stack, including the current one. + ); +impl Solution { + + pub fn sum_subarray_mins(mut arr: Vec) -> i32 { + let n = arr.len(); + let modular : i32 = 1000000000 + 7; + let mut stack = vec![]; + let mut left_nearest_lt_idx = vec![0i32; n]; + for i in 0..n { + while let Some(&last_idx) = stack.last() { + if !(arr[last_idx] < arr[i]) { + stack.pop(); + } else { + break; + } + } + + if let Some(&last_idx) = stack.last() { + left_nearest_lt_idx[i] = last_idx as i32; + } else { + left_nearest_lt_idx[i] = -1i32; + } + stack.push(i); + } + + stack.clear(); + let mut right_nearest_le_idx = vec![0i32; n]; + for i in (0..n).rev() { + while let Some(&last_idx) = stack.last() { + if !(arr[last_idx] <= arr[i]) { + stack.pop(); + } else { + break; + } + } + + if let Some(&last_idx) = stack.last() { + right_nearest_le_idx[i] = last_idx as i32; + } else { + right_nearest_le_idx[i] = n as i32; + } + stack.push(i); + } + + let mut sum = 0i32; + for i in (0..n) { + sum = (sum + arr[i] * (i as i32- left_nearest_lt_idx[i]) * (right_nearest_le_idx[i] - i as i32)) % modular; + } + sum + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_907() { + assert_eq!( + Solution::sum_subarray_mins(vec![3, 1, 2, 4]), + 17 + ); + } +} diff --git a/src/problem/p0910_smallest_range_ii.rs b/src/problem/p0910_smallest_range_ii.rs new file mode 100644 index 00000000..4eb8de6b --- /dev/null +++ b/src/problem/p0910_smallest_range_ii.rs @@ -0,0 +1,94 @@ +/** + * [910] Smallest Range II + * + * Given an array A of integers, for each integer A[i] we need to choose either x = -K or x = K, and add x to A[i] (only once). + * + * After this process, we have some array B. + * + * Return the smallest possible difference between the maximum value of B and the minimum value of B. + * + * + * + *
    + *
+ * + *
+ * Example 1: + * + * + * Input: A = [1], K = 0 + * Output: 0 + * Explanation: B = [1] + * + * + *
+ * Example 2: + * + * + * Input: A = [0,10], K = 2 + * Output: 6 + * Explanation: B = [2,8] + * + * + *
+ * Example 3: + * + * + * Input: A = [1,3,6], K = 3 + * Output: 3 + * Explanation: B = [4,6,3] + * + * + * + * + * Note: + * + *
    + * 1 <= A.length <= 10000 + * 0 <= A[i] <= 10000 + * 0 <= K <= 10000 + *
+ *
+ *
+ *
+ */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/smallest-range-ii/ +// discuss: https://leetcode.com/problems/smallest-range-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + // Refer to the discussion here. + pub fn smallest_range_ii(mut a: Vec, k: i32) -> i32 { + a.sort(); + + // for the case when all elements share the same operation. + let mut diff = a.last().unwrap() - a[0]; + + // Else: the result array must be of format: + // a[0] + k, a[1] + k, a[p] + k, a[p+1] -k ... a[n-1]-k + // Given p, the min of the array is min(a[0]+k, a[p+1]-k) + // and the max is max(a[p]+k, a[n-1]-k). + // Iterate p to minimize the gap between max - min. + let n = a.len(); + for p in 0..n-1 { + let min = std::cmp::min(a[0]+k, a[p+1]-k); + let max = std::cmp::max(a[p]+k, a[n-1]-k); + diff = std::cmp::min(diff, max - min); + } + diff + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_910() { + } +} diff --git a/src/problem/p0930_binary_subarrays_with_sum.rs b/src/problem/p0930_binary_subarrays_with_sum.rs new file mode 100644 index 00000000..8713f85f --- /dev/null +++ b/src/problem/p0930_binary_subarrays_with_sum.rs @@ -0,0 +1,78 @@ +/** + * [930] Binary Subarrays With Sum + * + * In an array A of 0s and 1s, how many non-empty subarrays have sum S? + * + * + * + * Example 1: + * + * + * Input: A = [1,0,1,0,1], S = 2 + * Output: 4 + * Explanation: + * The 4 subarrays are bolded below: + * [1,0,1,0,1] + * [1,0,1,0,1] + * [1,0,1,0,1] + * [1,0,1,0,1] + * + * + * + * + * Note: + * + *
    + * A.length <= 30000 + * 0 <= S <= A.length + * A[i] is either 0 or 1. + *
+ */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/binary-subarrays-with-sum/ +// discuss: https://leetcode.com/problems/binary-subarrays-with-sum/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn num_subarrays_with_sum(a: Vec, s: i32) -> i32 { + let mut cur_zero_count = 0; + let mut zero_counts = vec![]; + let s = s as usize; + for &num in &a { + if num == 1 { + zero_counts.push(cur_zero_count); + cur_zero_count = 0; + } else { + cur_zero_count += 1; + } + } + zero_counts.push(cur_zero_count); + println!("Zero_counts: {:?}", zero_counts); + let mut result = 0; + if s == 0 { + for i in 0..zero_counts.len()- s { + result += (zero_counts[i]) * (zero_counts[i] + 1) / 2; + } + } else { + for i in 0..zero_counts.len()- s { + result += (zero_counts[i] + 1) * (zero_counts[i+s] + 1); + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_930() { + assert_eq!(Solution::num_subarrays_with_sum(vec![1,0,1,0,1], 2), 4); + assert_eq!(Solution::num_subarrays_with_sum(vec![1,0,1,0,1], 3), 1); + } +} diff --git a/src/problem/p0959_regions_cut_by_slashes.rs b/src/problem/p0959_regions_cut_by_slashes.rs new file mode 100644 index 00000000..74a60974 --- /dev/null +++ b/src/problem/p0959_regions_cut_by_slashes.rs @@ -0,0 +1,174 @@ +/** + * [959] Regions Cut By Slashes + * + * In a N x N grid composed of 1 x 1 squares, each 1 x 1 square consists of a /, \, or blank space. These characters divide the square into contiguous regions. + * + * (Note that backslash characters are escaped, so a \ is represented as "\\".) + * + * Return the number of regions. + * + * + * + *
+ *
+ *
+ *
+ *
+ *
    + *
+ *
+ *
+ *
+ *
+ *
+ * + *
+ * Example 1: + * + * + * Input: + * [ + * " /", + * "/ " + * ] + * Output: 2 + * Explanation: The 2x2 grid is as follows: + * + * + * + *
+ * Example 2: + * + * + * Input: + * [ + * " /", + * " " + * ] + * Output: 1 + * Explanation: The 2x2 grid is as follows: + * + * + * + *
+ * Example 3: + * + * + * Input: + * [ + * "\\/", + * "/\\" + * ] + * Output: 4 + * Explanation: (Recall that because \ characters are escaped, "\\/" refers to \/, and "/\\" refers to /\.) + * The 2x2 grid is as follows: + * + * + * + *
+ * Example 4: + * + * + * Input: + * [ + * "/\\", + * "\\/" + * ] + * Output: 5 + * Explanation: (Recall that because \ characters are escaped, "/\\" refers to /\, and "\\/" refers to \/.) + * The 2x2 grid is as follows: + * + * + * + *
+ * Example 5: + * + * + * Input: + * [ + * "//", + * "/ " + * ] + * Output: 3 + * Explanation: The 2x2 grid is as follows: + * + * + * + * + * + * Note: + * + *
    + * 1 <= grid.length == grid[0].length <= 30 + * grid[i][j] is either '/', '\', or ' '. + *
+ *
+ *
+ *
+ *
+ *
+ */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/regions-cut-by-slashes/ +// discuss: https://leetcode.com/problems/regions-cut-by-slashes/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn dfs(ggrid: &mut Vec>, i : i32, j : i32) { + let n = ggrid.len() as i32; + if 0 <= i && i < n && 0 <= j && j < n && ggrid[i as usize][j as usize] == 0{ + ggrid[i as usize][j as usize] = 1; + Self::dfs(ggrid, i+1,j); + Self::dfs(ggrid, i-1,j); + Self::dfs(ggrid, i,j+1); + Self::dfs(ggrid, i,j-1); + } + } + + pub fn regions_by_slashes(grid: Vec) -> i32 { + let n = grid.len(); + let mut ggrid = vec![vec![0;3*n];3*n]; + for i in 0..n { + // transform to vec for constant reference time complexity + let row : Vec = grid[i].chars().collect(); + for j in 0..n { + if row[j] == '/' { + ggrid[3*i][3*j+2]=1; + ggrid[3*i+1][3*j+1]=1; + ggrid[3*i+2][3*j]=1; + } else if row[j] == '\\' { + ggrid[3*i][3*j]=1; + ggrid[3*i+1][3*j+1]=1; + ggrid[3*i+2][3*j+2]=1; + } else { + //do nothing + } + } + } + let mut count = 0i32; + for i in 0..3*n as i32 { + // transform to vec for constant reference time complexity + for j in 0..3*n as i32{ + if ggrid[i as usize][j as usize] == 0 { + Self::dfs(&mut ggrid, i, j); + count+=1; + } + } + } + count + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_959() { + assert_eq!(Solution::regions_by_slashes(vec![" /".to_owned(),"/ ".to_owned()]), 2); + } +} diff --git a/src/problem/p0969_pancake_sorting.rs b/src/problem/p0969_pancake_sorting.rs new file mode 100644 index 00000000..8edd0dd0 --- /dev/null +++ b/src/problem/p0969_pancake_sorting.rs @@ -0,0 +1,128 @@ +/** + * [969] Pancake Sorting + * + * Given an array of integers arr, sort the array by performing a series of pancake flips. + * In one pancake flip we do the following steps: + * + * Choose an integer k where 1 <= k <= arr.length. + * Reverse the sub-array arr[0...k-1] (0-indexed). + * + * For example, if arr = [3,2,1,4] and we performed a pancake flip choosing k = 3, we reverse the sub-array [3,2,1], so arr = [1,2,3,4] after the pancake flip at k = 3. + * Return an array of the k-values corresponding to a sequence of pancake flips that sort arr. Any valid answer that sorts the array within 10 * arr.length flips will be judged as correct. + * + * Example 1: + * + * Input: arr = [3,2,4,1] + * Output: [4,2,4,3] + * Explanation: + * We perform 4 pancake flips, with k values 4, 2, 4, and 3. + * Starting state: arr = [3, 2, 4, 1] + * After 1st flip (k = 4): arr = [1, 4, 2, 3] + * After 2nd flip (k = 2): arr = [4, 1, 2, 3] + * After 3rd flip (k = 4): arr = [3, 2, 1, 4] + * After 4th flip (k = 3): arr = [1, 2, 3, 4], which is sorted. + * + * Example 2: + * + * Input: arr = [1,2,3] + * Output: [] + * Explanation: The input is already sorted, so there is no need to flip anything. + * Note that other answers, such as [3, 3], would also be accepted. + * + * + * Constraints: + * + * 1 <= arr.length <= 100 + * 1 <= arr[i] <= arr.length + * All integers in arr are unique (i.e. arr is a permutation of the integers from 1 to arr.length). + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/pancake-sorting/ +// discuss: https://leetcode.com/problems/pancake-sorting/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + + pub fn reverse_at(arr: &mut Vec, first_n: usize) { + for i in 0..(first_n/2) { + arr.swap(i, first_n - i-1); + } + } + + pub fn pancake_sort(mut arr: Vec) -> Vec { + let mut result = vec![]; + let n = arr.len(); + for i in (1..n).rev() { + let mut max_num = 0; + let mut max_pos = 0; + for j in 0..=i { + if max_num < arr[j] { + max_num = arr[j]; + max_pos = j; + } + } + Self::reverse_at(&mut arr, max_pos+1); + Self::reverse_at(&mut arr, i+1); + result.push((max_pos + 1) as i32); + result.push((i+1) as i32); + + println!("{}, {}, arr={:?}", max_pos+1, i+1, arr); + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + use rand::seq::SliceRandom; + use rand::{thread_rng, Rng}; + + #[test] + fn test_969() { + Solution::pancake_sort(vec![3,2,4,1]); + // for _i in 0..20 { + // let mut rng = rand::thread_rng(); + // let size = rng.gen_range(0, 1000); + // let sorted_vector = make_sorted_vector(size); + // let mut shuffled_vector = make_shuffled_vector(&sorted_vector); + // let res = Solution::pancake_sort(shuffled_vector.clone()); + // let oper_num = res.len(); + // apply_pancake_sort_res(&mut shuffled_vector, res); + // assert_eq!(shuffled_vector, sorted_vector); + // assert!(oper_num < (size * 10) as usize); + // } + } + + fn make_sorted_vector(i: i32) -> Vec { + (1..i + 1).collect() + } + + fn make_shuffled_vector(a: &Vec) -> Vec { + let mut rng = thread_rng(); + let mut res = a.clone(); + res.shuffle(&mut rng); + res + } + + fn apply_pancake_sort_res(shuffled_vecter: &mut Vec, oper: Vec) { + for i in oper { + pancake_oper(shuffled_vecter, (i - 1) as usize); + } + } + + pub fn pancake_oper(a: &mut Vec, index: usize) { + let mut helper = Vec::new(); + for i in 0..(index + 1) { + helper.push(a[index - i]); + } + for i in 0..(index + 1) { + a[i] = helper[i]; + } + } +} diff --git a/src/problem/p0973_k_closest_points_to_origin.rs b/src/problem/p0973_k_closest_points_to_origin.rs new file mode 100644 index 00000000..9241f6e0 --- /dev/null +++ b/src/problem/p0973_k_closest_points_to_origin.rs @@ -0,0 +1,77 @@ +/** + * [973] K Closest Points to Origin + * + * Given an array of points where points[i] = [xi, yi] represents a point on the X-Y plane and an integer k, return the k closest points to the origin (0, 0). + * The distance between two points on the X-Y plane is the Euclidean distance (i.e., √(x1 - x2)^2 + (y1 - y2)^2). + * You may return the answer in any order. The answer is guaranteed to be unique (except for the order that it is in). + * + * Example 1: + * + * Input: points = [[1,3],[-2,2]], k = 1 + * Output: [[-2,2]] + * Explanation: + * The distance between (1, 3) and the origin is sqrt(10). + * The distance between (-2, 2) and the origin is sqrt(8). + * Since sqrt(8) < sqrt(10), (-2, 2) is closer to the origin. + * We only want the closest k = 1 points from the origin, so the answer is just [[-2,2]]. + * + * Example 2: + * + * Input: points = [[3,3],[5,-1],[-2,4]], k = 2 + * Output: [[3,3],[-2,4]] + * Explanation: The answer [[-2,4],[3,3]] would also be accepted. + * + * + * Constraints: + * + * 1 <= k <= points.length <= 10^4 + * -10^4 < xi, yi < 10^4 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/k-closest-points-to-origin/ +// discuss: https://leetcode.com/problems/k-closest-points-to-origin/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn k_closest(mut points: Vec>, k: i32) -> Vec> { + let pivot = points.pop().unwrap(); + + let mut lt_pivot = vec![]; + let mut ge_pivot = vec![]; + for ptr in points { + if ptr[0] * ptr[0] + ptr[1] * ptr[1] < pivot[0] * pivot[0] + pivot[1] * pivot[1] { + lt_pivot.push(ptr); + } else { + ge_pivot.push(ptr); + } + } + + if lt_pivot.len() == k as usize { + lt_pivot + } else if lt_pivot.len() + 1 == k as usize { + lt_pivot.push(pivot); + lt_pivot + } else if lt_pivot.len() < (k as usize) { + let mut right = Self::k_closest(ge_pivot, k - 1 - (lt_pivot.len()) as i32); + lt_pivot.push(pivot); + lt_pivot.append(&mut right); + lt_pivot + } else { + Self::k_closest(lt_pivot, k) + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_973() { + } +} diff --git a/src/problem/p0987_vertical_order_traversal_of_a_binary_tree.rs b/src/problem/p0987_vertical_order_traversal_of_a_binary_tree.rs new file mode 100644 index 00000000..85aa5ee5 --- /dev/null +++ b/src/problem/p0987_vertical_order_traversal_of_a_binary_tree.rs @@ -0,0 +1,147 @@ +/** + * [987] Vertical Order Traversal of a Binary Tree + * + * Given the root of a binary tree, calculate the vertical order traversal of the binary tree. + * For each node at position (row, col), its left and right children will be at positions (row + 1, col - 1) and (row + 1, col + 1) respectively. The root of the tree is at (0, 0). + * The vertical order traversal of a binary tree is a list of top-to-bottom orderings for each column index starting from the leftmost column and ending on the rightmost column. There may be multiple nodes in the same row and same column. In such a case, sort these nodes by their values. + * Return the vertical order traversal of the binary tree. + * + * Example 1: + * + * Input: root = [3,9,20,null,null,15,7] + * Output: [[9],[3,15],[20],[7]] + * Explanation: + * Column -1: Only node 9 is in this column. + * Column 0: Nodes 3 and 15 are in this column in that order from top to bottom. + * Column 1: Only node 20 is in this column. + * Column 2: Only node 7 is in this column. + * Example 2: + * + * Input: root = [1,2,3,4,5,6,7] + * Output: [[4],[2],[1,5,6],[3],[7]] + * Explanation: + * Column -2: Only node 4 is in this column. + * Column -1: Only node 2 is in this column. + * Column 0: Nodes 1, 5, and 6 are in this column. + * 1 is at the top, so it comes first. + * 5 and 6 are at the same position (2, 0), so we order them by their value, 5 before 6. + * Column 1: Only node 3 is in this column. + * Column 2: Only node 7 is in this column. + * + * Example 3: + * + * Input: root = [1,2,3,4,6,5,7] + * Output: [[4],[2],[1,5,6],[3],[7]] + * Explanation: + * This case is the exact same as example 2, but with nodes 5 and 6 swapped. + * Note that the solution remains the same since 5 and 6 are in the same location and should be ordered by their values. + * + * + * Constraints: + * + * The number of nodes in the tree is in the range [1, 1000]. + * 0 <= Node.val <= 1000 + * + */ +pub struct Solution {} +use crate::util::tree::{TreeNode, to_tree}; + +// problem: https://leetcode.com/problems/vertical-order-traversal-of-a-binary-tree/ +// discuss: https://leetcode.com/problems/vertical-order-traversal-of-a-binary-tree/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +// Definition for a binary tree node. +// #[derive(Debug, PartialEq, Eq)] +// pub struct TreeNode { +// pub val: i32, +// pub left: Option>>, +// pub right: Option>>, +// } +// +// impl TreeNode { +// #[inline] +// pub fn new(val: i32) -> Self { +// TreeNode { +// val, +// left: None, +// right: None +// } +// } +// } +use std::{borrow::Borrow, rc::Rc}; +use std::cell::RefCell; + +use std::cmp::Ordering; +#[derive(Eq)] +struct NodeInfo{node: Rc>, row: i32, col: i32} + +impl Ord for NodeInfo { + fn cmp(&self, other: &Self) -> Ordering { + (self.col, self.row, (*self.node).borrow().val).cmp(&(other.col, other.row, (*other.node).borrow().val)) + } +} + +impl PartialOrd for NodeInfo { + fn partial_cmp(&self, other: &Self) -> Option { + Some(self.cmp(other)) + } +} + +impl PartialEq for NodeInfo { + fn eq(&self, other: &Self) -> bool { + (self.col, self.row, (*self.node).borrow().val) == (other.col, other.row, (*other.node).borrow().val) + } +} + + +impl Solution { + fn traverse(node_infos : &mut Vec, node: Rc>, row: i32, col: i32) { + node_infos.push(NodeInfo{node: Rc::clone(&node), row: row, col: col}); + if let Some(left) = node.borrow_mut().left.take() { + Self::traverse(node_infos, left, row + 1, col - 1); + } + + if let Some(right) = node.borrow_mut().right.take() { + Self::traverse(node_infos, right, row + 1, col + 1); + } + } + + pub fn vertical_traversal(root: Option>>) -> Vec> { + if let Some(node) = root { + let mut node_infos = vec![]; + Self::traverse(&mut node_infos, node, 0, 0); + node_infos.sort(); + let mut last_col_num = node_infos[0].col; + let mut last_col = vec![(*node_infos[0].node).borrow().val]; + let mut result = vec![]; + + for i in 1..node_infos.len() { + let this_col_num = node_infos[i].col; + if this_col_num == last_col_num { + last_col.push((*node_infos[i].node).borrow().val); + } else { + result.push(last_col); + last_col_num = this_col_num; + last_col = vec![(*node_infos[i].node).borrow().val]; + } + } + + result.push(last_col); + result + } else { + vec![] + } + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_987() { + } +} diff --git a/src/problem/p1092_shortest_common_supersequence.rs b/src/problem/p1092_shortest_common_supersequence.rs new file mode 100644 index 00000000..f503ebb1 --- /dev/null +++ b/src/problem/p1092_shortest_common_supersequence.rs @@ -0,0 +1,96 @@ +/** + * [1092] Shortest Common Supersequence + * + * Given two strings str1 and str2, return the shortest string that has both str1 and str2 as subsequences. If multiple answers exist, you may return any of them. + * (A string S is a subsequence of string T if deleting some number of characters from T (possibly 0, and the characters are chosen anywhere from T) results in the string S.) + * + * Example 1: + * + * Input: str1 = "abac", str2 = "cab" + * Output: "cabac" + * Explanation: + * str1 = "abac" is a subsequence of "cabac" because we can delete the first "c". + * str2 = "cab" is a subsequence of "cabac" because we can delete the last "ac". + * The answer provided is the shortest such string that satisfies these properties. + * + * + * Note: + *
    + * 1 <= str1.length, str2.length <= 1000 + * str1 and str2 consist of lowercase English letters. + *
+ * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/shortest-common-supersequence/ +// discuss: https://leetcode.com/problems/shortest-common-supersequence/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + // TODO: This solution will time out at some large test case. + // May consider to sovlve by finding the longest common subsequence first, then the shorted common supersequence. + pub fn shortest_common_supersequence(str1: String, str2: String) -> String { + let str1_chars : Vec = str1.chars().collect(); + let str1_len : usize = str1_chars.len(); + let str2_chars : Vec = str2.chars().collect(); + let str2_len : usize = str2_chars.len(); + + let mut result = vec![vec!["".to_owned(); str2_len+1];str1_len+1]; + for i in 0..=str1_len { + result[i][0] = str1_chars.iter().take(i).cloned().collect(); + } + for j in 0..=str2_len { + result[0][j] = str2_chars.iter().take(j).cloned().collect(); + } + + for i in 1..=str1_len { + for j in 1..=str2_len { + let str1_char : char = str1_chars[i-1]; + let str2_char : char = str2_chars[j-1]; + if str1_char == str2_char { + let mut from_diag : String = result[i-1][j-1].clone(); + from_diag.push(str1_char); + result[i][j] = from_diag; + } else if result[i][j-1].len() < result[i-1][j].len(){ + let mut from_left : String = result[i][j-1].clone(); + from_left.push(str2_char); + result[i][j] = from_left; + } else { + let mut from_up : String = result[i-1][j].clone(); + from_up.push(str1_char); + result[i][j] = from_up; + } + + // let mut from_diag : String = result[i-1][j-1].clone(); + // if str1_char == str2_char { + // from_diag.push(str1_char); + // } else { + // from_diag.push(str1_char); + // from_diag.push(str2_char); + // } + + // let mut from_left : String = result[i][j-1].clone(); + // from_left.push(str2_char); + + // let mut from_up : String = result[i-1][j].clone(); + // from_up.push(str1_char); + + // result[i][j] = vec![from_diag, from_left, from_up].into_iter().min_by(|a,b|{a.len().cmp(&b.len())}).unwrap(); + } + } + result[str1_len][str2_len].clone() + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_1092() { + } +} diff --git a/src/problem/p1143_longest_common_subsequence.rs b/src/problem/p1143_longest_common_subsequence.rs new file mode 100644 index 00000000..121b8746 --- /dev/null +++ b/src/problem/p1143_longest_common_subsequence.rs @@ -0,0 +1,76 @@ +/** + * [1143] Longest Common Subsequence + * + * Given two strings text1 and text2, return the length of their longest common subsequence. If there is no common subsequence, return 0. + * A subsequence of a string is a new string generated from the original string with some characters (can be none) deleted without changing the relative order of the remaining characters. + * + * For example, "ace" is a subsequence of "abcde". + * + * A common subsequence of two strings is a subsequence that is common to both strings. + * + * Example 1: + * + * Input: text1 = "abcde", text2 = "ace" + * Output: 3 + * Explanation: The longest common subsequence is "ace" and its length is 3. + * + * Example 2: + * + * Input: text1 = "abc", text2 = "abc" + * Output: 3 + * Explanation: The longest common subsequence is "abc" and its length is 3. + * + * Example 3: + * + * Input: text1 = "abc", text2 = "def" + * Output: 0 + * Explanation: There is no such common subsequence, so the result is 0. + * + * + * Constraints: + * + * 1 <= text1.length, text2.length <= 1000 + * text1 and text2 consist of only lowercase English characters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/longest-common-subsequence/ +// discuss: https://leetcode.com/problems/longest-common-subsequence/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn longest_common_subsequence(text1: String, text2: String) -> i32 { + let text1 : Vec = text1.chars().collect(); + let text2 : Vec = text2.chars().collect(); + let n1 : usize = text1.len(); + let n2 : usize = text2.len(); + let mut result = vec![vec![0i32;n2 + 1];n1+1]; + for i in 1..=n1 { + for j in 1..=n2 { + if text1[i-1] == text2[j-1] { + result[i][j] = std::cmp::max(result[i][j], result[i-1][j-1]+1); + } else { + result[i][j] = std::cmp::max(result[i][j], result[i][j-1]); + result[i][j] = std::cmp::max(result[i][j], result[i-1][j]); + } + } + } + result[n1][n2] + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_1143() { + assert_eq!(Solution::longest_common_subsequence( "abcde".to_owned(), "ace".to_owned()), 3); + assert_eq!(Solution::longest_common_subsequence( "abc".to_owned(), "abc".to_owned()), 3); + assert_eq!(Solution::longest_common_subsequence( "abc".to_owned(), "def".to_owned()), 0); + } +} diff --git a/src/problem/p1329_sort_the_matrix_diagonally.rs b/src/problem/p1329_sort_the_matrix_diagonally.rs new file mode 100644 index 00000000..87052017 --- /dev/null +++ b/src/problem/p1329_sort_the_matrix_diagonally.rs @@ -0,0 +1,80 @@ +/** + * [1329] Sort the Matrix Diagonally + * + * A matrix diagonal is a diagonal line of cells starting from some cell in either the topmost row or leftmost column and going in the bottom-right direction until reaching the matrix's end. For example, the matrix diagonal starting from mat[2][0], where mat is a 6 x 3 matrix, includes cells mat[2][0], mat[3][1], and mat[4][2]. + * Given an m x n matrix mat of integers, sort each matrix diagonal in ascending order and return the resulting matrix. + * + * Example 1: + * + * Input: mat = [[3,3,1,1],[2,2,1,2],[1,1,1,2]] + * Output: [[1,1,1,1],[1,2,2,2],[1,2,3,3]] + * + * Example 2: + * + * Input: mat = [[11,25,66,1,69,7],[23,55,17,45,15,52],[75,31,36,44,58,8],[22,27,33,25,68,4],[84,28,14,11,5,50]] + * Output: [[5,17,4,1,52,7],[11,11,25,45,8,69],[14,23,25,44,58,15],[22,27,31,36,50,66],[84,28,75,33,55,68]] + * + * + * Constraints: + * + * m == mat.length + * n == mat[i].length + * 1 <= m, n <= 100 + * 1 <= mat[i][j] <= 100 + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/sort-the-matrix-diagonally/ +// discuss: https://leetcode.com/problems/sort-the-matrix-diagonally/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn sort(mat: &mut Vec>, ptrs: Vec<(usize, usize)>) { + let mut nums = Vec::new(); + for &ptr in &ptrs { + nums.push(mat[ptr.0][ptr.1]); + } + nums.sort(); + let mut i = 0; + for &ptr in &ptrs { + mat[ptr.0][ptr.1] = nums[i]; + i+=1; + } + } + + pub fn diagonal_sort(mut mat: Vec>) -> Vec> { + let mut start_pts = vec![]; + for i in 0..mat.len() { + start_pts.push((i, 0)); + } + for j in 1..mat[0].len() { + start_pts.push((0, j)); + } + + for start_pt in start_pts { + let mut i = start_pt.0; + let mut j = start_pt.1; + let mut diag = vec![]; + while i < mat.len() && j < mat[0].len() { + diag.push((i,j)); + i+=1; + j+=1; + } + Self::sort(&mut mat, diag); + } + mat + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_1329() { + } +} diff --git a/src/problem/p1424_diagonal_traverse_ii.rs b/src/problem/p1424_diagonal_traverse_ii.rs new file mode 100644 index 00000000..66a72f4e --- /dev/null +++ b/src/problem/p1424_diagonal_traverse_ii.rs @@ -0,0 +1,80 @@ +/** + * [1424] Diagonal Traverse II + * + * Given a list of lists of integers, nums, return all elements of nums in diagonal order as shown in the below images. + * + * Example 1: + * + * + * Input: nums = [[1,2,3],[4,5,6],[7,8,9]] + * Output: [1,4,2,7,5,3,8,6,9] + * + * Example 2: + * + * + * Input: nums = [[1,2,3,4,5],[6,7],[8],[9,10,11],[12,13,14,15,16]] + * Output: [1,6,2,8,7,3,9,4,12,10,5,13,11,14,15,16] + * + * Example 3: + * + * Input: nums = [[1,2,3],[4],[5,6,7],[8],[9,10,11]] + * Output: [1,4,2,5,3,8,6,9,7,10,11] + * + * Example 4: + * + * Input: nums = [[1,2,3,4,5,6]] + * Output: [1,2,3,4,5,6] + * + * + * Constraints: + * + * 1 <= nums.length <= 10^5 + * 1 <= nums[i].length <= 10^5 + * 1 <= nums[i][j] <= 10^9 + * There at most 10^5 elements in nums. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/diagonal-traverse-ii/ +// discuss: https://leetcode.com/problems/diagonal-traverse-ii/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +impl Solution { + pub fn find_diagonal_order(nums: Vec>) -> Vec { + let mut start_positions : Vec<(i32,i32)> = vec![]; + let row_count : usize = nums.len(); + let col_count : usize = nums[0].len(); + for i in 0..row_count { + start_positions.push((i as i32, 0 as i32)); + } + for j in 1..col_count { + start_positions.push((row_count as i32 - 1, j as i32)); + } + + let mut result : Vec = vec![]; + for start_pos in start_positions.iter() { + let mut i = start_pos.0; + let mut j = start_pos.1; + while 0 <= i && i < row_count as i32 && 0 <=j && j < col_count as i32 { + result.push(nums[i as usize][j as usize]); + i-=1; + j+=1; + } + } + result + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_1424() { + assert_eq!(Solution::find_diagonal_order(vec![vec![1,2,3],vec![4,5,6],vec![7,8,9]]), vec![1,4,2,7,5,3,8,6,9]); + } +} diff --git a/src/problem/p1647_minimum_deletions_to_make_character_frequencies_unique.rs b/src/problem/p1647_minimum_deletions_to_make_character_frequencies_unique.rs new file mode 100644 index 00000000..ecb0e56c --- /dev/null +++ b/src/problem/p1647_minimum_deletions_to_make_character_frequencies_unique.rs @@ -0,0 +1,87 @@ + +/** + * [1647] Minimum Deletions to Make Character Frequencies Unique + * + * A string s is called good if there are no two different characters in s that have the same frequency. + * Given a string s, return the minimum number of characters you need to delete to make s good. + * The frequency of a character in a string is the number of times it appears in the string. For example, in the string "aab", the frequency of 'a' is 2, while the frequency of 'b' is 1. + * + * Example 1: + * + * Input: s = "aab" + * Output: 0 + * Explanation: s is already good. + * + * Example 2: + * + * Input: s = "aaabbbcc" + * Output: 2 + * Explanation: You can delete two 'b's resulting in the good string "aaabcc". + * Another way it to delete one 'b' and one 'c' resulting in the good string "aaabbc". + * Example 3: + * + * Input: s = "ceabaacb" + * Output: 2 + * Explanation: You can delete both 'c's resulting in the good string "eabaab". + * Note that we only care about characters that are still in the string at the end (i.e. frequency of 0 is ignored). + * + * + * Constraints: + * + * 1 <= s.length <= 10^5 + * s contains only lowercase English letters. + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/minimum-deletions-to-make-character-frequencies-unique/ +// discuss: https://leetcode.com/problems/minimum-deletions-to-make-character-frequencies-unique/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here +use std::collections::HashMap; +impl Solution { + pub fn min_deletions(s: String) -> i32 { + let mut char_fqc = HashMap::new(); + s.chars().for_each(|c|{ + if let Some(fqc) = char_fqc.get_mut(&c) { + *fqc += 1; + } else { + char_fqc.insert(c, 1); + } + }); + + let mut fqc : Vec = char_fqc.values().map(|c|{*c}).collect(); + fqc.sort(); + let mut last_fqc = 0; + let mut gaps = vec![]; + let mut result = 0; + // println!("fqc: {:?}", fqc); + for i in 0..fqc.len() { + if last_fqc == fqc[i] { + if let Some(last_gap) = gaps.pop() { + result += fqc[i] - last_gap; + } else { + result += fqc[i]; // decrement to 0 + } + } else { + // due to the sort, last_fqc < fqc + gaps.append(&mut ((last_fqc+1)..(fqc[i])).collect()); + last_fqc = fqc[i]; + } + } + result as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_1647() { + assert_eq!(Solution::min_deletions("aaabbbcc".to_owned()), 2); + assert_eq!(Solution::min_deletions("aab".to_owned()), 0); + } +} diff --git a/src/problem/p1648_sell_diminishing_valued_colored_balls.rs b/src/problem/p1648_sell_diminishing_valued_colored_balls.rs new file mode 100644 index 00000000..3867caaa --- /dev/null +++ b/src/problem/p1648_sell_diminishing_valued_colored_balls.rs @@ -0,0 +1,151 @@ +/** + * [1648] Sell Diminishing-Valued Colored Balls + * + * You have an inventory of different colored balls, and there is a customer that wants orders balls of any color. + * The customer weirdly values the colored balls. Each colored ball's value is the number of balls of that color you currently have in your inventory. For example, if you own 6 yellow balls, the customer would pay 6 for the first yellow ball. After the transaction, there are only 5 yellow balls left, so the next yellow ball is then valued at 5 (i.e., the value of the balls decreases as you sell more to the customer). + * You are given an integer array, inventory, where inventory[i] represents the number of balls of the i^th color that you initially own. You are also given an integer orders, which represents the total number of balls that the customer wants. You can sell the balls in any order. + * Return the maximum total value that you can attain after selling orders colored balls. As the answer may be too large, return it modulo 10^9 + 7. + * + * Example 1: + * + * Input: inventory = [2,5], orders = 4 + * Output: 14 + * Explanation: Sell the 1st color 1 time (2) and the 2nd color 3 times (5 + 4 + 3). + * The maximum total value is 2 + 5 + 4 + 3 = 14. + * + * Example 2: + * + * Input: inventory = [3,5], orders = 6 + * Output: 19 + * Explanation: Sell the 1st color 2 times (3 + 2) and the 2nd color 4 times (5 + 4 + 3 + 2). + * The maximum total value is 3 + 2 + 5 + 4 + 3 + 2 = 19. + * + * Example 3: + * + * Input: inventory = [2,8,4,10,6], orders = 20 + * Output: 110 + * + * Example 4: + * + * Input: inventory = [1000000000], orders = 1000000000 + * Output: 21 + * Explanation: Sell the 1st color 1000000000 times for a total value of 500000000500000000. 500000000500000000 modulo 10^9 + 7 = 21. + * + * + * Constraints: + * + * 1 <= inventory.length <= 10^5 + * 1 <= inventory[i] <= 10^9 + * 1 <= orders <= min(sum(inventory[i]), 10^9) + * + */ +pub struct Solution {} + +// problem: https://leetcode.com/problems/sell-diminishing-valued-colored-balls/ +// discuss: https://leetcode.com/problems/sell-diminishing-valued-colored-balls/discuss/?currentPage=1&orderBy=most_votes&query= + +// submission codes start here + +use std::collections::{BTreeMap, HashMap}; +impl Solution { + // pub fn first_eq_pos(inventory: &Vec, target : i32) -> usize { + // let mut low = 0; + // let mut high = (inventory.len() - 1) as i32; + // while low <= high { + // let mid = (low + high) / 2; + // if inventory[mid as usize] == target { + // if mid == 0 || inventory[(mid-1) as usize] != target { + // return mid as usize; + // } + // high = mid - 1; + // } else if inventory[mid as usize] < target { + // low = mid + 1; + // } else { + // high = mid - 1; + // } + // } + // panic!("Shall not here"); + // } + + pub fn max_profit(mut inventory: Vec, orders: i32) -> i32 { + inventory.sort(); + let mut value = 0i64; + let mut num_frq = BTreeMap::new(); + let mut max_num = 0i64; + let mut orders = orders as i64; + for num in inventory { + let num = num as i64; + max_num = std::cmp::max(max_num, num); + if let Some(frq) = num_frq.get_mut(&num) { + *frq += 1; + } else { + num_frq.insert(num, 1); + } + } + + num_frq.insert(0, 0); + + let mut sub_max_val = max_num; + let mut acc_count = *num_frq.get(&max_num).unwrap(); + num_frq.remove(&max_num); + + for (&val, &count) in num_frq.iter().rev() { + + if acc_count * (sub_max_val - val) <= orders { + let sum = ((sub_max_val + val + 1) * (sub_max_val - val) / 2 * acc_count); + value += sum; + value = value % (1000000000 + 7); + + orders -= acc_count * (sub_max_val - val); + sub_max_val = val; + acc_count += count; + } else { + + let mut cur_max = sub_max_val; + while acc_count <= orders { + value += cur_max * acc_count; + value = value % (1000000000 + 7); + orders -= acc_count; + cur_max-=1; + } + value += cur_max * orders; + value = value % (1000000000 + 7); + + break + } + + } + + // while 0 < orders { + // let max_val = *inventory.last().unwrap(); + // let max_pos = Self::first_eq_pos(&inventory, max_val); + // let diff = if max_pos == 0 {max_val} else {max_val - inventory[max_pos - 1]}; + // orders -=1; + // value = (value + max_val) % (1000000000 + 7) ; + // inventory[max_pos]-=1; + // let count = std::cmp::min(diff, orders); + // let sum = (max_val + (max_val - count + 1)) * count / 2; + // println!("inventory: {:?}, orders: {}", inventory, orders); + // println!("sum: {:?}\n", sum); + // value += sum % (1000000000 + 7); + // inventory[max_pos] -= count; + // orders -= diff; + // } + + value as i32 + } +} + +// submission codes end + +#[cfg(test)] +mod tests { + use super::*; + + #[test] + fn test_1648() { + assert_eq!(Solution::max_profit(vec![2,5], 4), 14); + assert_eq!(Solution::max_profit(vec![3,5], 6), 19); + assert_eq!(Solution::max_profit(vec![1000000000], 1000000000), 21); + } +}